BYKdb

Annotate results for A0A0R2JUW8

A0A0R2JUW8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2JUW8
DOMAINcd57/246TSADPSEGKSTISFNVAVTWADQGNKVLLIDSDLRRPTVARSFRVSNSQGLTTILTEKQA
NLSESIHETEIPNLYVLPSGPVPPNPSELLNSSKMDQLLKVLKEQFDIIILDVPPVNTVT
DAQILASKVDGVILVVPQGIALKGAVLRARDLLKKVNANLIGAVLNRVTDTASGGYYGGY
YGGYYGTDDK
SITEWalker A64/66GKS
SITEWalker A'84/91LLIDSDLR
SITEWalker B165/171IILDVPP
SITEY Cluster232/241YYGGYYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALFKKKKQLDSNSMKHGVGLITVTKPTSSIAEQFRTIRTNIQFSSADRQLKTLVFTSADPSEGKSTISFNVAVTWADQG
                                                        TSADPSEGKSTISFNVAVTWADQG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NKVLLIDSDLRRPTVARSFRVSNSQGLTTILTEKQANLSESIHETEIPNLYVLPSGPVPPNPSELLNSSKMDQLLKVLKE
NKVLLIDSDLRRPTVARSFRVSNSQGLTTILTEKQANLSESIHETEIPNLYVLPSGPVPPNPSELLNSSKMDQLLKVLKE
   LLIDSDLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QFDIIILDVPPVNTVTDAQILASKVDGVILVVPQGIALKGAVLRARDLLKKVNANLIGAVLNRVTDTASGGYYGGYYGGY
QFDIIILDVPPVNTVTDAQILASKVDGVILVVPQGIALKGAVLRARDLLKKVNANLIGAVLNRVTDTASGGYYGGYYGGY
    IILDVPP                                                            YYGGYYGGY
       
....:..
YGTDDKK
YGTDDK 
Y      
© 1998-2019