BYKdb

Annotate results for A0A0R2JWJ9

A0A0R2JWJ9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2JWJ9
DOMAINcd57/246TSSEPSEGKSTVSSNLAVVWAKQKQKVVIIDADLRRPTAHRTFHVLNAAGLSSYLTNNAV
YEEIIQTTDVPNLSVISSGPVPPNPAEILNSHRINNLLERLQTEFDMIIIDAPPINTVTD
AQLLANKADGVVLVVPQGIAEKGSVTHAVDQLKTVHAKLLGTIMNRFKADKSPGYYGGYY
GGDYGGYYGV
SITEWalker A64/66GKS
SITEWalker A'84/91VIIDADLR
SITEWalker B164/170IIIDAPP
SITEY Cluster231/244YYGGYYGGDYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPLFRKKRKLDNESLKRGVGLITVTDPSSVVAEQFRTIRTNIQFSSVDKRLQSIVITSSEPSEGKSTVSSNLAVVWAKQK
                                                        TSSEPSEGKSTVSSNLAVVWAKQK
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QKVVIIDADLRRPTAHRTFHVLNAAGLSSYLTNNAVYEEIIQTTDVPNLSVISSGPVPPNPAEILNSHRINNLLERLQTE
QKVVIIDADLRRPTAHRTFHVLNAAGLSSYLTNNAVYEEIIQTTDVPNLSVISSGPVPPNPAEILNSHRINNLLERLQTE
   VIIDADLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDMIIIDAPPINTVTDAQLLANKADGVVLVVPQGIAEKGSVTHAVDQLKTVHAKLLGTIMNRFKADKSPGYYGGYYGGDY
FDMIIIDAPPINTVTDAQLLANKADGVVLVVPQGIAEKGSVTHAVDQLKTVHAKLLGTIMNRFKADKSPGYYGGYYGGDY
   IIIDAPP                                                            YYGGYYGGDY
       250 
....:....|.
GGYYGVDDKDD
GGYYGV     
GGYY       
© 1998-2019