BYKdb

Annotate results for A0A0R2KTQ4

A0A0R2KTQ4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2KTQ4
DOMAINcd56/248TSANISEGKSTVAANVAVTYAQAGRKVLLVDADLRRPTVHSTFNLSNHVGLSTVISSTAK
EVDLDSVVQESGVDNLYVLTAGPMPPNPAELIGSKRMRDFVKLTEERYDLVIIDLAPVLE
VSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEMLEFAKARILGYVMNDVSSDNAGYGYG
YGYGYGYGYGEED
SITE-196/-198GKT
SITEWalker A'83/90LLVDADLR
SITEWalker B166/172VIIDLAP
SITEY Cluster232/244YGYGYGYGYGYGY
SITEWalker A63/65GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPLFKKKRGTDDTIKNGAKLITVAKPKSPVAEQFRTVRTNINFMAVDHDIKSLAFTSANISEGKSTVAANVAVTYAQAGR
                                                       TSANISEGKSTVAANVAVTYAQAGR
                                                              GKS               
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVLLVDADLRRPTVHSTFNLSNHVGLSTVISSTAKEVDLDSVVQESGVDNLYVLTAGPMPPNPAELIGSKRMRDFVKLTE
KVLLVDADLRRPTVHSTFNLSNHVGLSTVISSTAKEVDLDSVVQESGVDNLYVLTAGPMPPNPAELIGSKRMRDFVKLTE
  LLVDADLR                                                                      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERYDLVIIDLAPVLEVSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEMLEFAKARILGYVMNDVSSDNAGYGYGYGYGY
ERYDLVIIDLAPVLEVSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEMLEFAKARILGYVMNDVSSDNAGYGYGYGYGY
     VIIDLAP                                                           YGYGYGYGY
       250       260
....:....|....:....|
GYGYGEEDTKKKGLFSKFRK
GYGYGEED            
GYGY                
© 1998-2019