BYKdb

Annotate results for A0A0R2KZR0

A0A0R2KZR0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2KZR0
DOMAINcd58/246TSSAPSEGKSTISNNVAVTWADQGKRVLIVDADMRRPTVYRTFRVSNAIGLSNLLAGTGN
LEGAIHETVVNNLSVMPSGPIPPNPSELLGSTKMVSLLETLTNAYDLVIIDAPPVNTVTD
AQVLAAHADGTVLVVPQGIADKAGVRHAKQLLEAVQANILGAILNRASAEKSTGYYGGYY
GGYYGTDDK
SITEWalker A65/67GKS
SITEWalker A'85/92LIVDADMR
SITEWalker B165/171VIIDAPP
SITEY Cluster232/241YYGGYYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFGKKKRQKKLDNESLKNGVGLITFTEPTSSIAEQFRTVRTNIQFSSVDKQLKSIVFTSSAPSEGKSTISNNVAVTWADQ
                                                         TSSAPSEGKSTISNNVAVTWADQ
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKRVLIVDADMRRPTVYRTFRVSNAIGLSNLLAGTGNLEGAIHETVVNNLSVMPSGPIPPNPSELLGSTKMVSLLETLTN
GKRVLIVDADMRRPTVYRTFRVSNAIGLSNLLAGTGNLEGAIHETVVNNLSVMPSGPIPPNPSELLGSTKMVSLLETLTN
    LIVDADMR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AYDLVIIDAPPVNTVTDAQVLAAHADGTVLVVPQGIADKAGVRHAKQLLEAVQANILGAILNRASAEKSTGYYGGYYGGY
AYDLVIIDAPPVNTVTDAQVLAAHADGTVLVVPQGIADKAGVRHAKQLLEAVQANILGAILNRASAEKSTGYYGGYYGGY
    VIIDAPP                                                            YYGGYYGGY
       
....:..
YGTDDKK
YGTDDK 
Y      
© 1998-2019