BYKdb

Annotate results for A0A0R2L487

A0A0R2L487 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2L487
DOMAINcd58/249TSADASEGKSTVSANVAVTWAQQGKKVLFVDADLRRPTVHSTFGLSNTQGLSTLLTMEKT
ENFSEFVQESPIDNLSVITSGPVPPNPSELLNSHRMDTFISKAREFFDMVVFDVPPMLTV
TDAQLLTAKVDGVILVVRFGVTNKAAITRTKELLDLAHANLLGYVMNDATGDAAGSGYGY
GYGYGYGYGYGK
SITE-248/-250GKT
SITEWalker A'85/92LFVDADLR
SITEWalker B167/173VVFDVPP
SITEY Cluster235/247YGYGYGYGYGYGY
SITEWalker A65/67GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALFHRNKKKLSEDTMLNGAKMITALHPKAVVSEQFRTIRTNIEFASVDRAIKTVTFTSADASEGKSTVSANVAVTWAQQ
                                                         TSADASEGKSTVSANVAVTWAQQ
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKKVLFVDADLRRPTVHSTFGLSNTQGLSTLLTMEKTENFSEFVQESPIDNLSVITSGPVPPNPSELLNSHRMDTFISKA
GKKVLFVDADLRRPTVHSTFGLSNTQGLSTLLTMEKTENFSEFVQESPIDNLSVITSGPVPPNPSELLNSHRMDTFISKA
    LFVDADLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REFFDMVVFDVPPMLTVTDAQLLTAKVDGVILVVRFGVTNKAAITRTKELLDLAHANLLGYVMNDATGDAAGSGYGYGYG
REFFDMVVFDVPPMLTVTDAQLLTAKVDGVILVVRFGVTNKAAITRTKELLDLAHANLLGYVMNDATGDAAGSGYGYGYG
      VVFDVPP                                                             YGYGYG
       250      
....:....|....:.
YGYGYGYGKTEDKKEG
YGYGYGYGK       
YGYGYGY         
© 1998-2019