BYKdb

Annotate results for A0A0R2M7H6

A0A0R2M7H6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2M7H6
DOMAINcd52/241TSAMLGEGKSTVSANLAVEYAKEGVRVLLVDADMRRPTVHKTFNLSNHQGLSSWLGRQLD
DVNKAIHPVLDNLFVMTSGPKPPNPAELLDGQLMADFLKTTTRKLDLVIVDAPPILPVTD
AQLLAHKVDGTVLVVRQNVAQKVAVRDAVVTLKKSHAHLLGAVFNDVRDGSHHGYYGYES
GYGYYSDEDK
SITEWalker A59/61GKS
SITEWalker A'79/86LLVDADMR
SITEWalker B159/165VIVDAPP
SITEY Cluster226/236YYGYESGYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFKRQVNNTTTAAINLTTINEPMAVVTEQIKTIRTNINFAASDRPLRTMMVTSAMLGEGKSTVSANLAVEYAKEGVRVLL
                                                   TSAMLGEGKSTVSANLAVEYAKEGVRVLL
                                                          GKS                 LL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDADMRRPTVHKTFNLSNHQGLSSWLGRQLDDVNKAIHPVLDNLFVMTSGPKPPNPAELLDGQLMADFLKTTTRKLDLVI
VDADMRRPTVHKTFNLSNHQGLSSWLGRQLDDVNKAIHPVLDNLFVMTSGPKPPNPAELLDGQLMADFLKTTTRKLDLVI
VDADMR                                                                        VI
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDAPPILPVTDAQLLAHKVDGTVLVVRQNVAQKVAVRDAVVTLKKSHAHLLGAVFNDVRDGSHHGYYGYESGYGYYSDED
VDAPPILPVTDAQLLAHKVDGTVLVVRQNVAQKVAVRDAVVTLKKSHAHLLGAVFNDVRDGSHHGYYGYESGYGYYSDED
VDAPP                                                            YYGYESGYGYY    
 
.
K
K

© 1998-2019