BYKdb

Annotate results for A0A0R2MUS5

A0A0R2MUS5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2MUS5
DOMAINcd43/234TSAMASAGKSTVSANVSITMAQVGKKTILIDADLRRPTLHSTFNVSNSNGLTTLLTSRAK
EMGANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLNLIEDLKQEYDMVVIDLAPVLD
AAETQLLTSSLDGTILVVRQAYSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGY
GYGYGYGYGYGE
SITEWalker A50/52GKS
SITEWalker A'70/77ILIDADLR
SITEWalker B153/159VVIDLAP
SITEY Cluster220/232YGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIAFTSAMASAGKSTVSANVSITMAQVGKKTILIDADLRRPT
                                          TSAMASAGKSTVSANVSITMAQVGKKTILIDADLRRPT
                                                 GKS                 ILIDADLR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LHSTFNVSNSNGLTTLLTSRAKEMGANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLNLIEDLKQEYDMVVIDLAPV
LHSTFNVSNSNGLTTLLTSRAKEMGANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLNLIEDLKQEYDMVVIDLAPV
                                                                        VVIDLAP 
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDAAETQLLTSSLDGTILVVRQAYSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYGYGYGYGEEKEKKG
LDAAETQLLTSSLDGTILVVRQAYSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYGYGYGYGE      
                                                           YGYGYGYGYGYGY        
      
....:.
LFGRKK


© 1998-2019