BYKdb

Annotate results for A0A0R2NQ84

A0A0R2NQ84 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2NQ84
DOMAINcd3/191TSAMLGEGKSTVSSNLAVEYANEGMKVLLVDADLRRPTVHKTFGLSNRQGLSSWLAHQTS
DINDAIHQTVDNLFVMTSGPKPPNPAELLGSKMMDEFLNSATRKLDLVIVDAPPILPVTD
SQLLANKVDGTVLVVRQNVAQKAAVRDAVSALKRSHAHILGAVLNDVSDGKHSGYYGYNN
GYYSEQDDQ
SITEWalker A10/12GKS
SITEWalker A'30/37LLVDADLR
SITEWalker B110/116VIVDAPP
SITEY Cluster177/185YYGYNNGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MITSAMLGEGKSTVSSNLAVEYANEGMKVLLVDADLRRPTVHKTFGLSNRQGLSSWLAHQTSDINDAIHQTVDNLFVMTS
  TSAMLGEGKSTVSSNLAVEYANEGMKVLLVDADLRRPTVHKTFGLSNRQGLSSWLAHQTSDINDAIHQTVDNLFVMTS
         GKS                 LLVDADLR                                           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPKPPNPAELLGSKMMDEFLNSATRKLDLVIVDAPPILPVTDSQLLANKVDGTVLVVRQNVAQKAAVRDAVSALKRSHAH
GPKPPNPAELLGSKMMDEFLNSATRKLDLVIVDAPPILPVTDSQLLANKVDGTVLVVRQNVAQKAAVRDAVSALKRSHAH
                             VIVDAPP                                            
       170       180       190 
....:....|....:....|....:....|.
ILGAVLNDVSDGKHSGYYGYNNGYYSEQDDQ
ILGAVLNDVSDGKHSGYYGYNNGYYSEQDDQ
                YYGYNNGYY      
© 1998-2019