BYKdb

Annotate results for A0A0R2NUN6

A0A0R2NUN6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2NUN6
DOMAINcd51/237TSSLTGEGKSTIAANLAVEFANNNKNVLLIDADMRRPTVHKTFGINNIEGLSTLLTKQRI
GINSCILKSKIERLNILPSGPIPPNPAELLSSKDMVEIIRNARKVFDVVLLDCPPILPVT
DARILAPLVDGTILVVRRGGISKKIVRESKSVLEQVRANLLGAVLNGFYNKETVGYYGET
YGSYSTK
SITEWalker A58/60GKS
SITEWalker A'78/85LLIDADMR
SITEWalker B159/165VLLDCPP
SITEY Cluster226/234YYGETYGSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFKKHKKLINDTQAIDLTTVNEPNSIISEQFKTIRTNIVFSASDIKTLMVTSSLTGEGKSTIAANLAVEFANNNKNVLLI
                                                  TSSLTGEGKSTIAANLAVEFANNNKNVLLI
                                                         GKS                 LLI
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADMRRPTVHKTFGINNIEGLSTLLTKQRIGINSCILKSKIERLNILPSGPIPPNPAELLSSKDMVEIIRNARKVFDVVL
DADMRRPTVHKTFGINNIEGLSTLLTKQRIGINSCILKSKIERLNILPSGPIPPNPAELLSSKDMVEIIRNARKVFDVVL
DADMR                                                                         VL
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
LDCPPILPVTDARILAPLVDGTILVVRRGGISKKIVRESKSVLEQVRANLLGAVLNGFYNKETVGYYGETYGSYSTK
LDCPPILPVTDARILAPLVDGTILVVRRGGISKKIVRESKSVLEQVRANLLGAVLNGFYNKETVGYYGETYGSYSTK
LDCPP                                                            YYGETYGSY   
© 1998-2019