BYKdb

Annotate results for A0A0R2XQ77

A0A0R2XQ77 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0R2XQ77
DOMAINtad44/201PQRSFKDYFLMFRERVWYLIVAFFIIFSGSILYTFNKTKVYTAVATVQLLRDDPSAMASA
EMEMNQIRSSEDLNTQISVLNSGAIVQGVERRLQDDERERFMAPYADVLSFTGPLSPAAL
LAQNRRIMPQRGTLMIGVGYNHPDPVIAARVANLFADE
DOMAINcd544/736TSTVPGEGKSFISSNLALTFANHGEKTLLLDGDLRLPNVARSLQLQNDFGLLDHIEKGVA
LDEVILKEVYPNLDVLPSGGKSKNPTQVLNSARFEAMIADLRDRYDRIVIDSPPLAAVSD
VLNLLPLADGVLYVIKFNTVKRKTAVVNVRRLWESNTPIFGAILNNISSTLASYYYSSYS
DKAYQDYYISQDV
SITE-623/-625GKS
SITEWalker A'571/578LLLDGDLR
SITEWalker B651/657IVIDSPP
SITEY Cluster717/731YYYSSYSDKAYQDYY
SITEWalker A551/553GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKNDYVRGAPDPNSGGYSGYGGYGSNSYSDGGYGAGGYGAGGAPQRSFKDYFLMFRERVWYLIVAFFIIFSGSILYTFNK
                                           PQRSFKDYFLMFRERVWYLIVAFFIIFSGSILYTFNK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TKVYTAVATVQLLRDDPSAMASAEMEMNQIRSSEDLNTQISVLNSGAIVQGVERRLQDDERERFMAPYADVLSFTGPLSP
TKVYTAVATVQLLRDDPSAMASAEMEMNQIRSSEDLNTQISVLNSGAIVQGVERRLQDDERERFMAPYADVLSFTGPLSP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AALLAQNRRIMPQRGTLMIGVGYNHPDPVIAARVANLFADEFINYNLTLNIDGSMKAVEDLRIRADQQKERVEELELKMA
AALLAQNRRIMPQRGTLMIGVGYNHPDPVIAARVANLFADE                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EYREDNNAVSLDSQENIAGTQLSTLNTIKLENKNVYDNLETRMGLVETFRREGRNLWELSFIAEESRVAGLLDRISGVKI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GISSSSKRYREKHPVMIEQLQILQESEVELVTAVKDSINKLSSAFAESKNNFELASQRLAEKEAELIELSKTRVEYSSLE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REMDVQQGFLQALVGRMTQERAAVNLKNPNSRVIDQAFPPLRHSSPNIAMNLAAGFFGGLAVGAGLIFAVAFLDDRVKSV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDIEGTIGLSMLGVVPRIKKLDSSSKAQAVASNIDRHVTESFRSIHSALRLSDESRHAKVLVTTSTVPGEGKSFISSNLA
                                                               TSTVPGEGKSFISSNLA
                                                                      GKS       
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTFANHGEKTLLLDGDLRLPNVARSLQLQNDFGLLDHIEKGVALDEVILKEVYPNLDVLPSGGKSKNPTQVLNSARFEAM
LTFANHGEKTLLLDGDLRLPNVARSLQLQNDFGLLDHIEKGVALDEVILKEVYPNLDVLPSGGKSKNPTQVLNSARFEAM
          LLLDGDLR                                                              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IADLRDRYDRIVIDSPPLAAVSDVLNLLPLADGVLYVIKFNTVKRKTAVVNVRRLWESNTPIFGAILNNISSTLASYYYS
IADLRDRYDRIVIDSPPLAAVSDVLNLLPLADGVLYVIKFNTVKRKTAVVNVRRLWESNTPIFGAILNNISSTLASYYYS
          IVIDSPP                                                           YYYS
       730       740       750    
....:....|....:....|....:....|....
SYSDKAYQDYYISQDVELEDELAGSVEPEMEPRS
SYSDKAYQDYYISQDV                  
SYSDKAYQDYY                       

© 1998-2019