BYKdb

Annotate results for A0A0R3E144

A0A0R3E144 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0R3E144
DOMAINtad29/208GFGDLVKLAVSFLRRQYIVIAVTVVLACAASVLYLRLAPPTYTAQAQVLLGIPRAQFVQQ
QSLLAEPAFDVTQIETQLQILKSKAIATKVFNQLKLADDPDFNGSSSSLLSSWHWARAQI
SASNNPPPSDTEDDPSEGALGVFLNRLSATRVGVSNVIEISFSSSSAPRAAEIVNAVANA
DOMAINcd580/769TSALPNEGKTTIAASLAQLIGHSGKRAIIVDCDLRNPSLTASICPKASAGLIEVSNGSRS
LEDVIWRDPKTNLVFLPAVRRGALFHTSEILSTEAICKLFERLRQTYDYVIVDLPPLTPL
VDVRVTSPLVDCYILVVEWGRTKTDVVQHALHTAPTISDSVIGAVLNKTNIKAMARYDAS
RSDYYNDSHY
SITEWalker A587/589GKT
SITEWalker A'607/614IIVDCDLR
SITEWalker B689/695VIVDLPP
SITE-686/-688YDY
SITEY Cluster763/772YYNDSHYIRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLQSNLLHTERTRVALSGQSSFDQPDSGGFGDLVKLAVSFLRRQYIVIAVTVVLACAASVLYLRLAPPTYTAQAQVLLGI
                            GFGDLVKLAVSFLRRQYIVIAVTVVLACAASVLYLRLAPPTYTAQAQVLLGI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRAQFVQQQSLLAEPAFDVTQIETQLQILKSKAIATKVFNQLKLADDPDFNGSSSSLLSSWHWARAQISASNNPPPSDTE
PRAQFVQQQSLLAEPAFDVTQIETQLQILKSKAIATKVFNQLKLADDPDFNGSSSSLLSSWHWARAQISASNNPPPSDTE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DDPSEGALGVFLNRLSATRVGVSNVIEISFSSSSAPRAAEIVNAVANAYVTDQLDARFEANRRATSWLQERMHDLGEQAL
DDPSEGALGVFLNRLSATRVGVSNVIEISFSSSSAPRAAEIVNAVANA                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAQRAVDTYKAQNNIVASDGKSIDEQLITQLNTRLAAARAQTSEASAKLTRYETLLSSDPARQPPLGGLDAIGTDATNST


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILTTLRQQYLELARREAELASRVGRDHLAVVNIRNRMREYRTSMFDEVRRLAEISRSEAELAKQRQQEIEKQLAEAVSKS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSVNSAELTIRDLESRAKGLRSLYESFLQRYMGSTQQETFPISETRVIFGASPPQSRSKPKTNLVLGLGMFAGVALGVLL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLLRDVMDGVFRTSSQIEAGLELPCLCLVPALQAPKPSKSPAKSSQAEEDLRSRTISNVPAIHRAVVEMPLSRFTEAIRS


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IKLAVDHSPAKTSNQVIGITSALPNEGKTTIAASLAQLIGHSGKRAIIVDCDLRNPSLTASICPKASAGLIEVSNGSRSL
                   TSALPNEGKTTIAASLAQLIGHSGKRAIIVDCDLRNPSLTASICPKASAGLIEVSNGSRSL
                          GKT                 IIVDCDLR                          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EDVIWRDPKTNLVFLPAVRRGALFHTSEILSTEAICKLFERLRQTYDYVIVDLPPLTPLVDVRVTSPLVDCYILVVEWGR
EDVIWRDPKTNLVFLPAVRRGALFHTSEILSTEAICKLFERLRQTYDYVIVDLPPLTPLVDVRVTSPLVDCYILVVEWGR
                                                VIVDLPP                         
       730       740       750       760       770       
....:....|....:....|....:....|....:....|....:....|....:..
TKTDVVQHALHTAPTISDSVIGAVLNKTNIKAMARYDASRSDYYNDSHYIRYGFSDS
TKTDVVQHALHTAPTISDSVIGAVLNKTNIKAMARYDASRSDYYNDSHY        
                                          YYNDSHYIRY     

© 1998-2019