BYKdb

Annotate results for A0A0R3MVJ9

A0A0R3MVJ9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0R3MVJ9
DOMAINtad27/202PTVDLREMGRILRRRYKMVALPAVALLSLAVVYLLFATTLYTATSTVLVDPRRANVVETN
QSVLSNFGTDDATIESQTLLIQSVAILTRVVGKLKLTEDEEFTPQPGLLDPVKSLFRSSG
PSDGASPEDAAKSRSVDILQKRMKVTRQGTTFLVDIAVSSRSPQKAANIANAIADA
DOMAINcd571/761TSALDSEGKTTLAINLAQSLATLGIRTLLIDGDLRNPQVTRALCPRADAGLLEVAIGRAA
PEQAVLVDHSTGLSVLPSTKIQQLEYITELMFSDRIVDVLDYFRHRYELIVIDSPPLVPL
VDGRALAELADRIVLATAWDQTPGEVLSHAMDLLSPVRERVMGTVLTRVDLSRLQFYDYY
RSSAYLKPYGA
SITEWalker A578/580GKT
SITEWalker A'598/605LLIDGDLR
SITEWalker B680/686IVIDSPP
SITE-672/-677YFRHRY
SITEY Cluster747/759YDYYRSSAYLKPY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLQRNSDLPYVIPDEPPARPAESWQYPTVDLREMGRILRRRYKMVALPAVALLSLAVVYLLFATTLYTATSTVLVDPRRA
                          PTVDLREMGRILRRRYKMVALPAVALLSLAVVYLLFATTLYTATSTVLVDPRRA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NVVETNQSVLSNFGTDDATIESQTLLIQSVAILTRVVGKLKLTEDEEFTPQPGLLDPVKSLFRSSGPSDGASPEDAAKSR
NVVETNQSVLSNFGTDDATIESQTLLIQSVAILTRVVGKLKLTEDEEFTPQPGLLDPVKSLFRSSGPSDGASPEDAAKSR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVDILQKRMKVTRQGTTFLVDIAVSSRSPQKAANIANAIADAYFDEQVRAKYDATRIAATWLNGQIDDLKSRVVASEKAV
SVDILQKRMKVTRQGTTFLVDIAVSSRSPQKAANIANAIADA                                      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EDFRSANNLMVSQGVTLNDQQITDLNGKLIAARAQTAEARAKYEQVQDIAKSGGDPGGINAAISSEMITKLRTQYADIAK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NEADLSSKYGARHPSVANVRAQRRDTQKLINEEIRRILESTKHDYDVARSREASLQQSLDQLQGVSTSSGQAQVRLRELQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REAEANRTQYESYLARSKETTAQESLEMPDSRIVTKASIPIRPSSPKTMLILGLAIMLGLGAGSVLAFLADYLDDRVKTL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERAEAIAGVPALAAVPLIGSRELAGLARRGRKELGRYDPKTTKLLPAPLQPPLTRYAIDEPGTFFAEAIRAVRLALQRTM


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSQPVKVVQVTSALDSEGKTTLAINLAQSLATLGIRTLLIDGDLRNPQVTRALCPRADAGLLEVAIGRAAPEQAVLVDHS
          TSALDSEGKTTLAINLAQSLATLGIRTLLIDGDLRNPQVTRALCPRADAGLLEVAIGRAAPEQAVLVDHS
                 GKT                 LLIDGDLR                                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGLSVLPSTKIQQLEYITELMFSDRIVDVLDYFRHRYELIVIDSPPLVPLVDGRALAELADRIVLATAWDQTPGEVLSHA
TGLSVLPSTKIQQLEYITELMFSDRIVDVLDYFRHRYELIVIDSPPLVPLVDGRALAELADRIVLATAWDQTPGEVLSHA
                                       IVIDSPP                                  
       730       740       750       760       770
....:....|....:....|....:....|....:....|....:....|
MDLLSPVRERVMGTVLTRVDLSRLQFYDYYRSSAYLKPYGAASLKVGAAR
MDLLSPVRERVMGTVLTRVDLSRLQFYDYYRSSAYLKPYGA         
                          YDYYRSSAYLKPY           

© 1998-2019