BYKdb

Annotate results for A0A0R3N604

A0A0R3N604 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R3N604
DOMAINcd91/270TSPTAGCGKTVTACNLALSISRLPERSVLLVDLDLRRPAVGNYLGISGTGGVLDVLEGRA
PLSSSVVQASVGPNNILVLPGGVSSNSSEWMASQTMGAMLQTIKRDFRSRIVIFDLPPML
LGDDVISILPRIDAALLVAGIGNTTVADIKECQRHLQRTPVIRVVVNKSTETVGSYYGYY
SITEWalker A98/100GKT
SITEWalker A'119/126LLVDLDLR
SITEWalker B202/208VIFDLPP
SITEY Cluster266/270YYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDSIKQAVELARAAEVHRPGALSGSALAAEGPLQRSAESPFNEVRLRADHLEANRIVAHGTSGQNGRYYDMLRTQVLQEM


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DKKSWQFLAVTSPTAGCGKTVTACNLALSISRLPERSVLLVDLDLRRPAVGNYLGISGTGGVLDVLEGRAPLSSSVVQAS
          TSPTAGCGKTVTACNLALSISRLPERSVLLVDLDLRRPAVGNYLGISGTGGVLDVLEGRAPLSSSVVQAS
                 GKT                  LLVDLDLR                                  
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VGPNNILVLPGGVSSNSSEWMASQTMGAMLQTIKRDFRSRIVIFDLPPMLLGDDVISILPRIDAALLVAGIGNTTVADIK
VGPNNILVLPGGVSSNSSEWMASQTMGAMLQTIKRDFRSRIVIFDLPPMLLGDDVISILPRIDAALLVAGIGNTTVADIK
                                         VIFDLPP                                
       250       260       270
....:....|....:....|....:....|
ECQRHLQRTPVIRVVVNKSTETVGSYYGYY
ECQRHLQRTPVIRVVVNKSTETVGSYYGYY
                         YYGYY
© 1998-2019