BYKdb

Annotate results for A0A0S2EL67

A0A0S2EL67 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S2EL67
DOMAINtad25/209GLIDFERILSAVRRQYKLVIACALGGLLLGVAYILTAVPVYTASADIFIDKGAPRLTDQF
SEPTAILQDEAQMLSQVELLKSTHLAESVAKRLHLAENEAFMKASPSVIGRITGAVKSLV
TFLPSLFWSPEIDPSSDEERIAEAASRLVRNVEVERVGRTYVLNLQYKAGTPVLAQQIAQ
GYADA
DOMAINcd568/760VSCLPSEGKSTTSSNLAVLLSSQDRRTILIDGDLRNPGLTRSLATRPETGLVETILDGRG
DAAPHLLWDASGRLAVLPAVMKQRISHSSELLSSASMGALMKEARAHFDYVLVDLPPLGA
IVDAKAFAHRVDAFVFVVEWGRTARHVVRSILRNNPTVAAKCLGIVLTKSDSSRMKLYRA
YGSSEYYSSRYDA
SITEWalker A575/577GKS
SITEWalker A'595/602ILIDGDLR
SITEWalker B678/684VLVDLPP
SITEY Cluster745/762YRAYGSSEYYSSRYDAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLHFPETRAPDVRSSEAADDHQLGGLIDFERILSAVRRQYKLVIACALGGLLLGVAYILTAVPVYTASADIFIDKGAPRL
                        GLIDFERILSAVRRQYKLVIACALGGLLLGVAYILTAVPVYTASADIFIDKGAPRL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TDQFSEPTAILQDEAQMLSQVELLKSTHLAESVAKRLHLAENEAFMKASPSVIGRITGAVKSLVTFLPSLFWSPEIDPSS
TDQFSEPTAILQDEAQMLSQVELLKSTHLAESVAKRLHLAENEAFMKASPSVIGRITGAVKSLVTFLPSLFWSPEIDPSS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DEERIAEAASRLVRNVEVERVGRTYVLNLQYKAGTPVLAQQIAQGYADAYLDDQLEAKYDATRRAGNWLQDRIAELQRQS
DEERIAEAASRLVRNVEVERVGRTYVLNLQYKAGTPVLAQQIAQGYADA                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YDADLAVEKFRTDNNLIASNGQLVSEQQLTGVSSQLVTAKAETAEAKARYDQIRGLMESGRTDAVVNDALVSTTINSLRE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QYLSASRREADISAKLGANHVQAVRLRDQMKDYERLIFAELGRISESYGNAYKVALAREQSLEANLTQSLAVNADANTTQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRLRELERQSQAFKTLYETFLQRYQETIQQQSFPVTQARIITRAEVPQKASAPKKPLMLAFFTFLGIGAGTAAGAWREYR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DRFFRVGDQVIRETGLEFLGYLPLVKPNPRQVSEAGALAAGGVLWAPGAIAAHTRDHPMSSFAETLRNVRIAADVSLPDE


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSKVIGIVSCLPSEGKSTTSSNLAVLLSSQDRRTILIDGDLRNPGLTRSLATRPETGLVETILDGRGDAAPHLLWDASGR
       VSCLPSEGKSTTSSNLAVLLSSQDRRTILIDGDLRNPGLTRSLATRPETGLVETILDGRGDAAPHLLWDASGR
              GKS                 ILIDGDLR                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAVLPAVMKQRISHSSELLSSASMGALMKEARAHFDYVLVDLPPLGAIVDAKAFAHRVDAFVFVVEWGRTARHVVRSILR
LAVLPAVMKQRISHSSELLSSASMGALMKEARAHFDYVLVDLPPLGAIVDAKAFAHRVDAFVFVVEWGRTARHVVRSILR
                                     VLVDLPP                                    
       730       740       750       760    
....:....|....:....|....:....|....:....|....
NNPTVAAKCLGIVLTKSDSSRMKLYRAYGSSEYYSSRYDAYYRN
NNPTVAAKCLGIVLTKSDSSRMKLYRAYGSSEYYSSRYDA    
                        YRAYGSSEYYSSRYDAYY  

© 1998-2019