BYKdb

Annotate results for A0A0S2ELS6

A0A0S2ELS6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S2ELS6
DOMAINtad21/197PTELLVQIWGIVRRHMLLIGAAVAVSLALAVIYLLLAPPQFTATATMVMDARRSTTMMNP
SVSANVAETPLDNPTVESQLEILRSENIALAVVRQLKLDEDPDFTRPTGLGAVKRSLRSL
VSSNEPPTPEQRLRAAVAEVDNNLYVRRIGVTFVFEISFTSTSPQRAAEVANAVADA
DOMAINcd542/731VSGLPGEGKTTLAANFAELAAQSGARTVLVDCDLRNPSLTRRLAGSARVRLTDLRDGTAA
AHAMLRTRDGRLDFLPAVQLEDGTSSNDVLSSRAMAETLAHLKQHYDYVVVDLPPLLPII
DARASADMIDCFVFTVEWGGTLIDNARRSLELSDRIQRRTVGVVLNKVDGRQAKRYFEYE
YAPGKSAYYG
SITEWalker A549/551GKT
SITEWalker A'569/576VLVDCDLR
SITEWalker B650/656VVVDLPP
SITE-647/-649YDY
SITE-725/-727GKS
SITEY Cluster717/730YFEYEYAPGKSAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLHRVHPAAHAPEAGSAILSPTELLVQIWGIVRRHMLLIGAAVAVSLALAVIYLLLAPPQFTATATMVMDARRSTTMMNP
                    PTELLVQIWGIVRRHMLLIGAAVAVSLALAVIYLLLAPPQFTATATMVMDARRSTTMMNP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVSANVAETPLDNPTVESQLEILRSENIALAVVRQLKLDEDPDFTRPTGLGAVKRSLRSLVSSNEPPTPEQRLRAAVAEV
SVSANVAETPLDNPTVESQLEILRSENIALAVVRQLKLDEDPDFTRPTGLGAVKRSLRSLVSSNEPPTPEQRLRAAVAEV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DNNLYVRRIGVTFVFEISFTSTSPQRAAEVANAVADAYVTDQLDAKYQSTRRAGVWLQERLAELGAQASEADRAVVDFRA
DNNLYVRRIGVTFVFEISFTSTSPQRAAEVANAVADA                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TNNIVDAGGGRLLSEQQLTELNTQLSAARGNASEARARLDRVEQMIGSDLADSTLTDALRNEVIIKLRNQYSELTKREAD


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAKRLGPQHQAVANVRGEIAEAKRSINEELGRIGEGYRSDYEIARARVATIEASLKEAIGQSQLSSQAQVQLRALESSAQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SYRALYDSFLQRYRETVQQQSFPLTEARLITSASPPGQKSKPRTSMALAGALVLGGIAGFGLAFLRDATDKTLRRPSDVE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQLGVPCIASVPAVETVRGKEASGLREVVARPIARFAESIRAIKVAVDFHPTERGPQIVGFVSGLPGEGKTTLAANFAEL
                                                             VSGLPGEGKTTLAANFAEL
                                                                    GKT         
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAQSGARTVLVDCDLRNPSLTRRLAGSARVRLTDLRDGTAAAHAMLRTRDGRLDFLPAVQLEDGTSSNDVLSSRAMAETL
AAQSGARTVLVDCDLRNPSLTRRLAGSARVRLTDLRDGTAAAHAMLRTRDGRLDFLPAVQLEDGTSSNDVLSSRAMAETL
        VLVDCDLR                                                                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AHLKQHYDYVVVDLPPLLPIIDARASADMIDCFVFTVEWGGTLIDNARRSLELSDRIQRRTVGVVLNKVDGRQAKRYFEY
AHLKQHYDYVVVDLPPLLPIIDARASADMIDCFVFTVEWGGTLIDNARRSLELSDRIQRRTVGVVLNKVDGRQAKRYFEY
         VVVDLPP                                                            YFEY
       730 
....:....|.
EYAPGKSAYYG
EYAPGKSAYYG
EYAPGKSAYY 

© 1998-2019