BYKdb

Annotate results for A0A0S2HYK8

A0A0S2HYK8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S2HYK8
DOMAINtad11/252DTFDIITFKRILYRSVWIGLFIILLALGAGFLKIRYTAPLYEAKSVIQIQEDKKTSQVFQ
LDDLYEDNKKLNKTIALIRSKEFLKRTFAKLPLDIRYFVEGAFLSDEIYQSSPFEIQYKI
KDSKAFGIPVFISFKDKKNVVFEYEYNGETYSYPGEAGKWTDLGILSCKAEILRYNVIKS
MYESAKQNSYYFVIYNDEQIFTEHSKKLNIKLLSSSSNSIEISYQSHNSQQAADLVNAVA
RE
DOMAINcd593/782TSTISGEGKTFVAMNLAGIQAISGKRAIILDMDMRKPRLHLGFNVDNDKGMSTILIGKHT
YKDCIFMSEQKNLDFITAGPVPPNPAELVFSPKMDELIEQLEELYDVIIIDTPPIGIVTD
ALANLQRANYPVYVLKSNLSKRNFLENINSLIKDKRLDNLSVVFNSVDMAKRRYGYGYGY
GYGYGYGYGY
SITEWalker A600/602GKT
SITEWalker A'620/627IILDMDMR
SITEWalker B700/706IIIDTPP
SITE-722/-725YPVY
SITEY Cluster766/783YGYGYGYGYGYGYGYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQNRKIPIINDTFDIITFKRILYRSVWIGLFIILLALGAGFLKIRYTAPLYEAKSVIQIQEDKKTSQVFQLDDLYEDNKK
          DTFDIITFKRILYRSVWIGLFIILLALGAGFLKIRYTAPLYEAKSVIQIQEDKKTSQVFQLDDLYEDNKK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNKTIALIRSKEFLKRTFAKLPLDIRYFVEGAFLSDEIYQSSPFEIQYKIKDSKAFGIPVFISFKDKKNVVFEYEYNGET
LNKTIALIRSKEFLKRTFAKLPLDIRYFVEGAFLSDEIYQSSPFEIQYKIKDSKAFGIPVFISFKDKKNVVFEYEYNGET

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YSYPGEAGKWTDLGILSCKAEILRYNVIKSMYESAKQNSYYFVIYNDEQIFTEHSKKLNIKLLSSSSNSIEISYQSHNSQ
YSYPGEAGKWTDLGILSCKAEILRYNVIKSMYESAKQNSYYFVIYNDEQIFTEHSKKLNIKLLSSSSNSIEISYQSHNSQ

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAADLVNAVAREFQRFEVEKKKESIQNILAFIERQLKNVYKTLDTTESKLQEFKKENNIPSEALERTPFPIFTAKIEEFE
QAADLVNAVARE                                                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQITTLDFELITLKNVKTQLETNQQLNTYEMIATLAGTNSEKVLVSILTNLQNLINEKNQLLNDVTENNMRIKIIDKQIA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NQKKLIIDFVKNNINRLEEKRAEYQSKIEEYEEKLFADESFDKLEYARLQRLHSINEGFYNQLIQKKAEYMISQAGYVTQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NVILERANANLKSIAPKKEQILIASFILGLILFFTFIFIRYLMFNEITSINMIKNYSSAPVIGVVPAYKKAVPVSQLLVN


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKPNSMFTEAFRNIRSNLQFLSPGAGSNVITVTSTISGEGKTFVAMNLAGIQAISGKRAIILDMDMRKPRLHLGFNVDND
                                TSTISGEGKTFVAMNLAGIQAISGKRAIILDMDMRKPRLHLGFNVDND
                                       GKT                 IILDMDMR             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KGMSTILIGKHTYKDCIFMSEQKNLDFITAGPVPPNPAELVFSPKMDELIEQLEELYDVIIIDTPPIGIVTDALANLQRA
KGMSTILIGKHTYKDCIFMSEQKNLDFITAGPVPPNPAELVFSPKMDELIEQLEELYDVIIIDTPPIGIVTDALANLQRA
                                                           IIIDTPP              
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NYPVYVLKSNLSKRNFLENINSLIKDKRLDNLSVVFNSVDMAKRRYGYGYGYGYGYGYGYGYYSDEEKPSKKNFLKSIFK
NYPVYVLKSNLSKRNFLENINSLIKDKRLDNLSVVFNSVDMAKRRYGYGYGYGYGYGYGYGY                  
                                             YGYGYGYGYGYGYGYGYY                 
  
..
TN


© 1998-2019