BYKdb

Annotate results for A0A0S2KED6

A0A0S2KED6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S2KED6
DOMAINtad22/272DEIDLGYLLAICLDNKWLIIIITALVTLAGAAYAWLATPEYRADALLQVEQRGGNLASME
SIITMQEQTGSTTQSEILRSRMIMGQAAQQAGLDLVVQPRRFPIIGAALTRRGTERPGWA
QGSADAWAGDSITVDEMRVEQALQGQPITLKITGPDNYTLINENEQTLGNGRVGTLFSSD
TPYIELLVSRLQAPANVEFTLIKRSDTQMIRNLQGRFNVAQRGRDTGILELTLTGPDPEE
LRRSLDAISNV
DOMAINcd575/766TGPSPAVGKSFISTNLAAICSQGGQKVLLIDSDLRKGHIHRSFAGHSEQGLSDYLVGDIT
LEQMIRHTELEGLDYVARGTAPPNPSELLMTRKFNEFLEEAGQHYDLVIIDTPPALAVTD
AAVVGKQVGATLMITRFRENNPKEIERALQQLESAGVSVKGSILNAIERSASSYYGYGYG
YGYYHYAYKSDE
SITEWalker A582/584GKS
SITEWalker A'602/609LLIDSDLR
SITEWalker B682/688VIIDTPP
SITEY Cluster748/762YYGYGYGYGYYHYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTETSSPSNRPRSSQSQQQADDEIDLGYLLAICLDNKWLIIIITALVTLAGAAYAWLATPEYRADALLQVEQRGGNLASM
                     DEIDLGYLLAICLDNKWLIIIITALVTLAGAAYAWLATPEYRADALLQVEQRGGNLASM

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESIITMQEQTGSTTQSEILRSRMIMGQAAQQAGLDLVVQPRRFPIIGAALTRRGTERPGWAQGSADAWAGDSITVDEMRV
ESIITMQEQTGSTTQSEILRSRMIMGQAAQQAGLDLVVQPRRFPIIGAALTRRGTERPGWAQGSADAWAGDSITVDEMRV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQALQGQPITLKITGPDNYTLINENEQTLGNGRVGTLFSSDTPYIELLVSRLQAPANVEFTLIKRSDTQMIRNLQGRFNV
EQALQGQPITLKITGPDNYTLINENEQTLGNGRVGTLFSSDTPYIELLVSRLQAPANVEFTLIKRSDTQMIRNLQGRFNV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQRGRDTGILELTLTGPDPEELRRSLDAISNVYLVQNINRQAAEAESRLEFLEQQTPLIQDGLNSAENRLNEYRASQDSV
AQRGRDTGILELTLTGPDPEELRRSLDAISNV                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLSFETRSMLERLVSLETELNALQIQESEVAQRFTPSHPNYRSLLDKRAQLLGEQQRLEAQVNNLPETQRQVLRLNRDVE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSQQIYMQMLNAQQELRIARAGTVGNVRILDNALVGGSPIAPRTNLILVISLMAGLMLGLMVVLLRHMLHRGVTSVEELQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALGLQVYATIPLSERQLKIFDRFSDRKSRKRLKNVVGKQLAERMSKTGKRRKHGEDGGVLALIDPSDLAIEALRSLRTSL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HFAMLEAPNNRLMLTGPSPAVGKSFISTNLAAICSQGGQKVLLIDSDLRKGHIHRSFAGHSEQGLSDYLVGDITLEQMIR
              TGPSPAVGKSFISTNLAAICSQGGQKVLLIDSDLRKGHIHRSFAGHSEQGLSDYLVGDITLEQMIR
                     GKS                 LLIDSDLR                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HTELEGLDYVARGTAPPNPSELLMTRKFNEFLEEAGQHYDLVIIDTPPALAVTDAAVVGKQVGATLMITRFRENNPKEIE
HTELEGLDYVARGTAPPNPSELLMTRKFNEFLEEAGQHYDLVIIDTPPALAVTDAAVVGKQVGATLMITRFRENNPKEIE
                                         VIIDTPP                                
       730       740       750       760       
....:....|....:....|....:....|....:....|....:..
RALQQLESAGVSVKGSILNAIERSASSYYGYGYGYGYYHYAYKSDEA
RALQQLESAGVSVKGSILNAIERSASSYYGYGYGYGYYHYAYKSDE 
                           YYGYGYGYGYYHYAY     

© 1998-2019