BYKdb

Annotate results for A0A0S2M268

A0A0S2M268 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S2M268
DOMAINtad11/147KSLDVRDYVRVFRQHWLGVVALTLIGILCSAGWIFLQKPVYAANSIGYVSIPGGDNMGSA
LAGDNLAKSKATSYASFGSSRPVAESVIKTLNLDVKPDVLLQQITVTSAKDTPEVKIVAT
AQTPQEAQALANAWVVA
DOMAINcd291/480TSSIPSEGKSTIAANLAVTIAATGQKVVLIDGDLRRPVVADFFGLAGGGGLTDILSGQAE
LDDVLQVYGPVPSLAVLGAGRIPPNPSELLGSLAMKRLLERLSKEAVVLIDAPPLLPVTD
AAILARSTDGALIVAGAGKTTIDELEKAVATLAKVKAPLLGAVLNRVPTTGGQAAGYGYY
GKGYYYGQND
SITE-428/-430GKT
SITEWalker A'318/325VLIDGDLR
SITEWalker B398/404VLIDAPP
SITEY Cluster467/476YGYYGKGYYY
SITEWalker A298/300GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEDEQLVTVEKSLDVRDYVRVFRQHWLGVVALTLIGILCSAGWIFLQKPVYAANSIGYVSIPGGDNMGSALAGDNLAKSK
          KSLDVRDYVRVFRQHWLGVVALTLIGILCSAGWIFLQKPVYAANSIGYVSIPGGDNMGSALAGDNLAKSK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATSYASFGSSRPVAESVIKTLNLDVKPDVLLQQITVTSAKDTPEVKIVATAQTPQEAQALANAWVVALAEQVKVLESTTD
ATSYASFGSSRPVAESVIKTLNLDVKPDVLLQQITVTSAKDTPEVKIVATAQTPQEAQALANAWVVA             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGPEAGAESIIKVVPLGDAPLPLAPTSPNKKMALVIGALAGLIIGIAYALIRNHLDRRIRSVEMVEKAIGTAVVGTIPVD


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERMRDGRRVVANAVIDHSSTEGYAISEALRELRTNLHYMNVDNPPRVIVITSSIPSEGKSTIAANLAVTIAATGQKVVLI
                                                  TSSIPSEGKSTIAANLAVTIAATGQKVVLI
                                                         GKS                 VLI
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGDLRRPVVADFFGLAGGGGLTDILSGQAELDDVLQVYGPVPSLAVLGAGRIPPNPSELLGSLAMKRLLERLSKEAVVLI
DGDLRRPVVADFFGLAGGGGLTDILSGQAELDDVLQVYGPVPSLAVLGAGRIPPNPSELLGSLAMKRLLERLSKEAVVLI
DGDLR                                                                        VLI
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAPPLLPVTDAAILARSTDGALIVAGAGKTTIDELEKAVATLAKVKAPLLGAVLNRVPTTGGQAAGYGYYGKGYYYGQND
DAPPLLPVTDAAILARSTDGALIVAGAGKTTIDELEKAVATLAKVKAPLLGAVLNRVPTTGGQAAGYGYYGKGYYYGQND
DAPP                                                              YGYYGKGYYY    
       490       500       510       520       530       540 
....:....|....:....|....:....|....:....|....:....|....:....|.
AAKAGKRNRKTQASTPAPEGIQQGVNNGGPGAGKEMSAEQEFDLLLHPADGPPTRRMTRQR


© 1998-2019