BYKdb

Annotate results for A0A0S3K4N1

A0A0S3K4N1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S3K4N1
DOMAINtad14/254DEIDLGKLFGSILDAKWLILCTVVLFSIIGVGVAILSTPIYKADALIQIESKSSGGISAM
VGDMGELFSAESSATTEIEIIKSRMILGGTVDKFNLTTVVSPNYMPIIGKGLARLQGEQI
SLSVSRFNAPSYAVGVPLTLEVIDSEKQTFRLLEDDNNVILEGKVGELLEKNGYQFLATE
LVAQTGDSFTVSKISKLDAINKLQENLSISERGKQTGIISLSFSGEDRAKIQDILNDISQ
N
DOMAINcd533/722SGPAPSIGKTFVSTNFAAVAAKTGQKVLLIDADMRKGYLQQCFGLRWDNGLSDYLSGKTS
LSNIIKSTSIDNLDVVTRGQVPPNPSELLMHPRFKSFVDEMSAQYDLVIIDTPPVLAVTD
PSIVGALAGTTLMVARFDQTTLKEIEVAQGRFEQSGVEVKGVILNAVEKKASNSYGYGYG
YYNYAYKSES
SITE-589/-591GKT
SITEWalker A'560/567LLIDADMR
SITEWalker B640/646VIIDTPP
SITEY Cluster707/718YGYGYGYYNYAY
SITEWalker A540/542GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTTQTIKQSRQADDEIDLGKLFGSILDAKWLILCTVVLFSIIGVGVAILSTPIYKADALIQIESKSSGGISAMVGDMGEL
             DEIDLGKLFGSILDAKWLILCTVVLFSIIGVGVAILSTPIYKADALIQIESKSSGGISAMVGDMGEL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FSAESSATTEIEIIKSRMILGGTVDKFNLTTVVSPNYMPIIGKGLARLQGEQISLSVSRFNAPSYAVGVPLTLEVIDSEK
FSAESSATTEIEIIKSRMILGGTVDKFNLTTVVSPNYMPIIGKGLARLQGEQISLSVSRFNAPSYAVGVPLTLEVIDSEK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QTFRLLEDDNNVILEGKVGELLEKNGYQFLATELVAQTGDSFTVSKISKLDAINKLQENLSISERGKQTGIISLSFSGED
QTFRLLEDDNNVILEGKVGELLEKNGYQFLATELVAQTGDSFTVSKISKLDAINKLQENLSISERGKQTGIISLSFSGED

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAKIQDILNDISQNYFLQNVQRNSAEAEQSLEFLKGHLPDIKTKLTASEDVLNRFRQENESIDLGLEAQSTLKVMVELEA
RAKIQDILNDISQN                                                                  

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLNELTFKESEISQRFTQDHPAYKSLLDKRETLLKEKERLNKQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELNI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IKAGTVGNVRILDNAQSFSKPIKPKKALIVVLATLLGGIAGVAFVLIRAAFHRGVETPDQIEQIGMPVYASVPKSIQQLE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FANKLKRNKGSNNELVLLAEANPADLSIEALRSLRTSLHFAMMEAKNNVLMISGPAPSIGKTFVSTNFAAVAAKTGQKVL
                                                    SGPAPSIGKTFVSTNFAAVAAKTGQKVL
                                                           GKT                 L
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIDADMRKGYLQQCFGLRWDNGLSDYLSGKTSLSNIIKSTSIDNLDVVTRGQVPPNPSELLMHPRFKSFVDEMSAQYDLV
LIDADMRKGYLQQCFGLRWDNGLSDYLSGKTSLSNIIKSTSIDNLDVVTRGQVPPNPSELLMHPRFKSFVDEMSAQYDLV
LIDADMR                                                                        V
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIDTPPVLAVTDPSIVGALAGTTLMVARFDQTTLKEIEVAQGRFEQSGVEVKGVILNAVEKKASNSYGYGYGYYNYAYKS
IIDTPPVLAVTDPSIVGALAGTTLMVARFDQTTLKEIEVAQGRFEQSGVEVKGVILNAVEKKASNSYGYGYGYYNYAYKS
IIDTPP                                                            YGYGYGYYNYAY  
  
..
ES
ES

© 1998-2019