BYKdb

Annotate results for A0A0S3TG69

A0A0S3TG69 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0S3TG69
DOMAINcd41/230TSVQPGEGKSTLSANIAISFAKAGLKTLLIDADIRNSVMSGTFKADEKYEGLSSYLSGNA
ELSAVISHTNIENLMLIPAGHVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVI
DSAIISQKADANILVTEAGAIKRRFIQKAKEQMEQSGALFLGVILNKVEETLDSYGGYGS
YGAYGNYGKP
SITEWalker A48/50GKS
SITEWalker A'68/75LLIDADIR
SITEWalker B149/155VIIDTPP
SITE-89/-95YEGLSSY
SITEY Cluster215/227YGGYGSYGAYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARLELVKSKKELYDIAEEYYNSIRTNIQFSGRDLKVITLTSVQPGEGKSTLSANIAISFAKAGLKTLLIDADIRNSVMS
                                        TSVQPGEGKSTLSANIAISFAKAGLKTLLIDADIRNSVMS
                                               GKS                 LLIDADIR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTFKADEKYEGLSSYLSGNAELSAVISHTNIENLMLIPAGHVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVI
GTFKADEKYEGLSSYLSGNAELSAVISHTNIENLMLIPAGHVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVI
                                                                    VIIDTPP     
       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
DSAIISQKADANILVTEAGAIKRRFIQKAKEQMEQSGALFLGVILNKVEETLDSYGGYGSYGAYGNYGKPAKKKSRKRR
DSAIISQKADANILVTEAGAIKRRFIQKAKEQMEQSGALFLGVILNKVEETLDSYGGYGSYGAYGNYGKP         
                                                      YGGYGSYGAYGNY            
© 1998-2019