BYKdb

Annotate results for A0A0S3TIS7

A0A0S3TIS7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S3TIS7
DOMAINtad9/157EEIDFQKYLLVLQRRWMTAVGVFGVVFTLALLYALSTKPTYTAQASLLIKTSRTSSLTGL
GEDLGRLESLVQDNSPVDTQAKIVTSVPVLQATITSLSLKNDEGEPLKVEDLQKKLKVEG
VKGTDVLEVSYTHQDPQLAAKVINKIVEE
DOMAINcd534/722TSSIPKEGKSEVSANLAVAMAQVERRVLLVDADMRHPIQHHIWQLSNNQGLSNIIVDQVP
LETIVHEVMPNLHVLTSGVMPPNPVALLDSDRMATLVASFNQKYDCVIFDAPPLAGTADA
AVLGKLADGILLVVRPEVVDYASANAAKEFLTQSDQTVLGMVINGVSVKREPDSYFYYAK
DSVESTGVS
SITEWalker A541/543GKS
SITEWalker A'561/568LLVDADMR
SITE-587/-593IIVDQVP
SITEY Cluster708/711YFYY
SITEWalker B640/646VIFDAPP
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKESEFHVEEIDFQKYLLVLQRRWMTAVGVFGVVFTLALLYALSTKPTYTAQASLLIKTSRTSSLTGLGEDLGRLESLVQ
        EEIDFQKYLLVLQRRWMTAVGVFGVVFTLALLYALSTKPTYTAQASLLIKTSRTSSLTGLGEDLGRLESLVQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DNSPVDTQAKIVTSVPVLQATITSLSLKNDEGEPLKVEDLQKKLKVEGVKGTDVLEVSYTHQDPQLAAKVINKIVEEYTK
DNSPVDTQAKIVTSVPVLQATITSLSLKNDEGEPLKVEDLQKKLKVEGVKGTDVLEVSYTHQDPQLAAKVINKIVEE   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QNIQANREEAISAGKFMLQQLPKTEEAVQKAELALRRFKERNKIIVLQEEATAAVNTISRLEDEIAQAQAQLVDVNARLE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLQTQARVNSQEAVSAVDLSQVPGTQKVLTELQEAQSELTVARTRYQPGHPTVANLEEKVSALRSLLQQRVEQVGGNNQQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISTANLQMGEVRQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
INVAENQNVSNARIISPALVPDEPSGTRKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTVKEARELFQYTLLGVIPNVS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNTKNSYSVQGLDRPIPRVVGRDIPHFPVGDAYQMLQANLKFLSYKQLKAITVTSSIPKEGKSEVSANLAVAMAQVERRV
                                                     TSSIPKEGKSEVSANLAVAMAQVERRV
                                                            GKS                 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLVDADMRHPIQHHIWQLSNNQGLSNIIVDQVPLETIVHEVMPNLHVLTSGVMPPNPVALLDSDRMATLVASFNQKYDCV
LLVDADMRHPIQHHIWQLSNNQGLSNIIVDQVPLETIVHEVMPNLHVLTSGVMPPNPVALLDSDRMATLVASFNQKYDCV
LLVDADMR                                                                       V
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IFDAPPLAGTADAAVLGKLADGILLVVRPEVVDYASANAAKEFLTQSDQTVLGMVINGVSVKREPDSYFYYAKDSVESTG
IFDAPPLAGTADAAVLGKLADGILLVVRPEVVDYASANAAKEFLTQSDQTVLGMVINGVSVKREPDSYFYYAKDSVESTG
IFDAPP                                                             YFYY         
       730  
....:....|..
VSRKSILVRNHR
VS          

© 1998-2019