BYKdb

Annotate results for A0A0S3TXC5

A0A0S3TXC5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S3TXC5
DOMAINtad20/171PDPGYGQLFGVLMRRKIWFLGALAGTIALAAGVTAFMPPTYRSTMQMLIESNYRERRTPG
DNSVSFADPNVETDTATQVNLMRSTPLLQRAVDELKPRYSDIDVDRLTRRLNIVQVQELR
GNERVNTNIVEMSYIDHDRVKTREVLKALQRV
DOMAINcd558/741TSALAGEGKSTVALGLAISAARLHQRVLLIDADLRRPGLHHQLQLPNDHGLSTLLTSDRA
LTQSAIQPASTYSDLPISVLTAGPTPTDSVKLLSSKRMRDLMTVFEQHYDLVILDAPPVL
GIVDALLAASFCDGALLVGRMGHVDRNQVSQAVGMLSRLNLVGVVANCSESGHSYYYRSA
PTPA
SITEWalker A565/567GKS
SITEWalker A'585/592LLIDADLR
SITEWalker B669/675VILDAPP
SITEY Cluster732/734YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIVAQGNITLFNPSSPMQEPDPGYGQLFGVLMRRKIWFLGALAGTIALAAGVTAFMPPTYRSTMQMLIESNYRERRTPGD
                   PDPGYGQLFGVLMRRKIWFLGALAGTIALAAGVTAFMPPTYRSTMQMLIESNYRERRTPGD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSVSFADPNVETDTATQVNLMRSTPLLQRAVDELKPRYSDIDVDRLTRRLNIVQVQELRGNERVNTNIVEMSYIDHDRVK
NSVSFADPNVETDTATQVNLMRSTPLLQRAVDELKPRYSDIDVDRLTRRLNIVQVQELRGNERVNTNIVEMSYIDHDRVK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TREVLKALQRVYQDYNLEQQRNRLAKGLSFIDRQIPQVQAKVDKAEADLEQFRKSSNLVDPEDQSRALVESLRELQKDQQ
TREVLKALQRV                                                                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNRGELASAQARFSALQQQLARSPEQATIASRLSQSRQYQALLAEIQKTEVALAQQQTRFTAKTPFVQQLLDQRERQVAL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQQEAQRVLGSEASSIAGSDAGLFSTGQLGENDLKFASDLTQAQVDFFAARARDQSLVAEAQRLQAQLQRFPTLLAEYNR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLPTVKLQRDTLDQLEKARQELGLEIARGGFDWQVVEQSKVGRQVGPNWMRNLMVGAAGGLLLGCVAAFLRESADKSIRT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEDLTKQASIPLIGMVPELPLSELMPTTNFAFGRSTNAGDTSMLQVLHWAPFRESLDLIYKNLQLMTDGSPMRSLVVTSA
                                                                             TSA

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAGEGKSTVALGLAISAARLHQRVLLIDADLRRPGLHHQLQLPNDHGLSTLLTSDRALTQSAIQPASTYSDLPISVLTAG
LAGEGKSTVALGLAISAARLHQRVLLIDADLRRPGLHHQLQLPNDHGLSTLLTSDRALTQSAIQPASTYSDLPISVLTAG
    GKS                 LLIDADLR                                                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTPTDSVKLLSSKRMRDLMTVFEQHYDLVILDAPPVLGIVDALLAASFCDGALLVGRMGHVDRNQVSQAVGMLSRLNLVG
PTPTDSVKLLSSKRMRDLMTVFEQHYDLVILDAPPVLGIVDALLAASFCDGALLVGRMGHVDRNQVSQAVGMLSRLNLVG
                            VILDAPP                                             
       730       740 
....:....|....:....|.
VVANCSESGHSYYYRSAPTPA
VVANCSESGHSYYYRSAPTPA
           YYY       

© 1998-2019