BYKdb

Annotate results for A0A0S3TXS2

A0A0S3TXS2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S3TXS2
DOMAINtad13/161EDFDLQSYWLVLKRRWLVAAGVFAATVGLAGLATSLQRPNYEATGRVLVQSNRTTSLTGV
GERVGTLEALRREGNPLDTQAAVVTSYPILQRVIDTLQLKNSQGRPMEPEELSRQVKVEA
VPTTDILELKYADDDPEMAANVINQIVKA
DOMAINcd539/725SSAVPREGKSEVAANLAATMAQSGRKVLLVDADMRNPSQHHLWGLVNSVGLSNVVVDQSE
LRQAVKPITSNLSVLTAGVMPPNPLSILDSEAMTVFLETVSKDYDYIVFDTPPLAGTADA
AVLGKMADGVLIAVRPGVADAASVAAAKSLLARSEPNILGLVANGVNVRYEPDSYFYYTN
REQVSDR
SITEWalker A546/548GKS
SITEWalker A'566/573LLVDADMR
SITEWalker B645/651IVFDTPP
SITE-642/-644YDY
SITEY Cluster708/716YEPDSYFYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTSMNIETKRYSEDFDLQSYWLVLKRRWLVAAGVFAATVGLAGLATSLQRPNYEATGRVLVQSNRTTSLTGVGERVGTLE
            EDFDLQSYWLVLKRRWLVAAGVFAATVGLAGLATSLQRPNYEATGRVLVQSNRTTSLTGVGERVGTLE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALRREGNPLDTQAAVVTSYPILQRVIDTLQLKNSQGRPMEPEELSRQVKVEAVPTTDILELKYADDDPEMAANVINQIVK
ALRREGNPLDTQAAVVTSYPILQRVIDTLQLKNSQGRPMEPEELSRQVKVEAVPTTDILELKYADDDPEMAANVINQIVK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AYIDSNLKTNQEEANKAGRFIDSQIPPAEEALNKASEDLRNFRAQNGIVDLERESAANINSAAVLQDQLSQARAQLADVG
A                                                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQERAVADQLGLELGQAIDLASLSQSAGVQDVLAQLQSVESRLVTEQARFKDTTPQIQTLKQQRDDLNALLQTRVSDAVG


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANVSVAPGALQVGDIKRNLAAALSTLQSQRIGLEGRISTLAGLLANYRSRAAQTPALIQQEGELQRRQEIALTAYQNLNA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKQEIEVAKNQQVGNARVLQSAMVPTRPAGRMRLILLAAGAMVGLLLGIAAAFLVDSIDKSLKTVKDAEAQYGYTLLGLV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRFETSDTPTILSPGADDISPRVIAMTSPRSMIHEAYQMLQANLKFMSLDKKVKTIVISSAVPREGKSEVAANLAATMAQ
                                                          SSAVPREGKSEVAANLAATMAQ
                                                                 GKS            
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGRKVLLVDADMRNPSQHHLWGLVNSVGLSNVVVDQSELRQAVKPITSNLSVLTAGVMPPNPLSILDSEAMTVFLETVSK
SGRKVLLVDADMRNPSQHHLWGLVNSVGLSNVVVDQSELRQAVKPITSNLSVLTAGVMPPNPLSILDSEAMTVFLETVSK
     LLVDADMR                                                                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DYDYIVFDTPPLAGTADAAVLGKMADGVLIAVRPGVADAASVAAAKSLLARSEPNILGLVANGVNVRYEPDSYFYYTNRE
DYDYIVFDTPPLAGTADAAVLGKMADGVLIAVRPGVADAASVAAAKSLLARSEPNILGLVANGVNVRYEPDSYFYYTNRE
    IVFDTPP                                                        YEPDSYFYY    
       730        
....:....|....:...
QVSDRGERGERTRSLLTK
QVSDR             

© 1998-2019