BYKdb

Annotate results for A0A0S4L511

A0A0S4L511 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S4L511
DOMAINtad18/200RETVLAEYAGACRRRVWLIVVIVVGCAAAAAVWSFMQIPRYQAKATVVVEQVGRSGLEYD
RDYRQGDLSPEYFQTQFELMKSHYIFQRTAQLLHLSEQPEYKPRPSILSSTMGDILPAAV
AGVVGFKGDVDAQVLGDEDERLLKQFAEAIEIVPIRGARLAHVMATSNDPEFAARIANTL
AST
DOMAINcd555/748TSPGEGEGKTTLSVNLAVALAQLENTKVLLIDADLRNPSHKYIHGVQREGIDTNGLANFL
AGRASLREIIYRTDLANLSVIPRGDRPPNPSELLHSKQLRELLNRCREERYHVILDAPPV
LPVTDPVILASQVDGVLLVASAGQTTREACRAAIDQLTSAGGRILGIVLQKVRVSTNLYP
SYVGKKFEENGIPL
SITEWalker A562/564GKT
SITEWalker A'583/590LLIDADLR
SITEWalker B667/673VILDAPP
SITEY Cluster733/736YPSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTRDDDSISPQSAESNGRETVLAEYAGACRRRVWLIVVIVVGCAAAAAVWSFMQIPRYQAKATVVVEQVGRSGLEYDRDY
                 RETVLAEYAGACRRRVWLIVVIVVGCAAAAAVWSFMQIPRYQAKATVVVEQVGRSGLEYDRDY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQGDLSPEYFQTQFELMKSHYIFQRTAQLLHLSEQPEYKPRPSILSSTMGDILPAAVAGVVGFKGDVDAQVLGDEDERLL
RQGDLSPEYFQTQFELMKSHYIFQRTAQLLHLSEQPEYKPRPSILSSTMGDILPAAVAGVVGFKGDVDAQVLGDEDERLL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KQFAEAIEIVPIRGARLAHVMATSNDPEFAARIANTLASTYIERTQELNALSKEKAAAWYIAHLDELRKKAEDSQQALYQ
KQFAEAIEIVPIRGARLAHVMATSNDPEFAARIANTLAST                                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FRLKHGLMGGREQQTARAHTNTELDSELVRAEMKQAEAKSRLEQIESILRSRTGHNGAIETDWSSLDASTEVLSSTLMQT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRAQDIRVSGQVAELEDTYGPLHPKLIHAKAEMQDLHERIEQEVQKIFDSVKQEYDSARGRVRVIKEAASRHRQEKIKLE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QYEVDYGILEREAESTQHLYDIFLKQTKEADLSAGLRSANVYLADPAVPNAIPVKPKKQLNIMLGLLVGLMTGVGLALFL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EARDRTLRGPDDLGRYLPKVSLLGVMPLLPKTKIGEGVSLLTQQSSGVAAEHVRIIRTSVLLSRPDELPSCVLITSPGEG
                                                                          TSPGEG

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EGKTTLSVNLAVALAQLENTKVLLIDADLRNPSHKYIHGVQREGIDTNGLANFLAGRASLREIIYRTDLANLSVIPRGDR
EGKTTLSVNLAVALAQLENTKVLLIDADLRNPSHKYIHGVQREGIDTNGLANFLAGRASLREIIYRTDLANLSVIPRGDR
 GKT                  LLIDADLR                                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPNPSELLHSKQLRELLNRCREERYHVILDAPPVLPVTDPVILASQVDGVLLVASAGQTTREACRAAIDQLTSAGGRILG
PPNPSELLHSKQLRELLNRCREERYHVILDAPPVLPVTDPVILASQVDGVLLVASAGQTTREACRAAIDQLTSAGGRILG
                          VILDAPP                                               
       730       740        
....:....|....:....|....:...
IVLQKVRVSTNLYPSYVGKKFEENGIPL
IVLQKVRVSTNLYPSYVGKKFEENGIPL
            YPSY            

© 1998-2019