BYKdb

Annotate results for A0A0S4NBC6

A0A0S4NBC6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S4NBC6
DOMAINtad17/188ETINLYEVIQVLYRGKWLIILVFILVVLATAIFTFMQDPIYESTAVVLIEKGKKGLGLTE
AFDITGLSEQRNIKNEIEILKSRSLAEAVAKKLIERVYVNPQTKKDTILVILPSKKELRE
GIKPFAKIETILERFNKDVKIESPRDADIIKITVRSKNPEEAALIANTFADA
DOMAINcd578/766ASGAPKEGKSTTSSNLAITMAKADLKTVLLDTDLRRPVLHRVFGVKREPGLTDYLFGRAE
IDEIFKQTEVENLYLVPCGIVPPNPSELLGSEKMKEFIEYLKSNYDMVIFDTPPLVAVTD
ALILANQVDGVLLVASAGKTEIDVIDKAREMIHRVGGNIIGVLLNNFDASATYGTYYRYY
RYYRYYDYY
SITEWalker A585/587GKS
SITEWalker A'605/612VLLDTDLR
SITEWalker B685/691VIFDTPP
SITE-677/-682YLKSNY
SITE-715/-717GKT
SITEY Cluster750/766YGTYYRYYRYYRYYDYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKLSTNGQTFFQNEEETINLYEVIQVLYRGKWLIILVFILVVLATAIFTFMQDPIYESTAVVLIEKGKKGLGLTEAFDI
                ETINLYEVIQVLYRGKWLIILVFILVVLATAIFTFMQDPIYESTAVVLIEKGKKGLGLTEAFDI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGLSEQRNIKNEIEILKSRSLAEAVAKKLIERVYVNPQTKKDTILVILPSKKELREGIKPFAKIETILERFNKDVKIESP
TGLSEQRNIKNEIEILKSRSLAEAVAKKLIERVYVNPQTKKDTILVILPSKKELREGIKPFAKIETILERFNKDVKIESP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDADIIKITVRSKNPEEAALIANTFADAYYERNLMMSRNESRSVRKFLEEQLADKKKILDQAETQLETYMKSAGVVALDE
RDADIIKITVRSKNPEEAALIANTFADA                                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESKKLIEQLSDLESKRGEAIVEISSAQKKLNAYLEQIKQIEPEFVKVATEALDPYIKYLQEEIAKLEVTRDQIVAQNPKV


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSKEVLDKSLREIDEQLASLRKKLQEKISEFLKTGFASSGTPGTQTYDPTGFVKELKQKILLTEIELTAYEAKKKELERL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
INQLNQKFETIPSKLIDYARLERARMSSEKLYLLIEEKYQEAMIAEQSQFGYVQIIDYATPGIKPVSPKVHLNLILSVLI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLGLGVMIVFVKEYFDRTIKTPEQIEKKGFTVLSAIPVIEIEAKVDGKQLKKDEGRNIAAHLITHLSPKSPVAEAYRVLR


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGIQFAKLDRKIKSIVVASGAPKEGKSTTSSNLAITMAKADLKTVLLDTDLRRPVLHRVFGVKREPGLTDYLFGRAEIDE
                 ASGAPKEGKSTTSSNLAITMAKADLKTVLLDTDLRRPVLHRVFGVKREPGLTDYLFGRAEIDE
                        GKS                 VLLDTDLR                            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IFKQTEVENLYLVPCGIVPPNPSELLGSEKMKEFIEYLKSNYDMVIFDTPPLVAVTDALILANQVDGVLLVASAGKTEID
IFKQTEVENLYLVPCGIVPPNPSELLGSEKMKEFIEYLKSNYDMVIFDTPPLVAVTDALILANQVDGVLLVASAGKTEID
                                            VIFDTPP                             
       730       740       750       760       770       
....:....|....:....|....:....|....:....|....:....|....:..
VIDKAREMIHRVGGNIIGVLLNNFDASATYGTYYRYYRYYRYYDYYGADRDKGEGKS
VIDKAREMIHRVGGNIIGVLLNNFDASATYGTYYRYYRYYRYYDYY           
                             YGTYYRYYRYYRYYDYY           

© 1998-2019