BYKdb

Annotate results for A0A0S4XR18

A0A0S4XR18 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0S4XR18
DOMAINcd419/609SSNIPEEGKTTISANLARTLAKGNKKVVLLDLDMRKSKLLREFSNLNVKDGSSSLLVGKV
ALDDVIIHAGENLDVIFAGKIPPNPSELLLSSNVEKIVNELKNSYDYVIIDTAPIGLVTD
TMILLKKHIHDLFLVVVRSEFTDKSLLVNFNKMTHKHHLHSVGLILNGVKISQGNYYGYG
YGYGYGTNEKI
SITEWalker A426/428GKT
SITEWalker A'446/453VLLDLDMR
SITEWalker B526/532VIIDTAP
SITE-523/-525YDY
SITEY Cluster594/603YYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAQNSTKPWEIDGEYKFGQAIKTPYFTFVIKATKDFGLNDTSYKIIHQSNKNSFIDGFIRPNLNVAQISKQASIVKITFE


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAIPQRGVDIVNNLVKVYFAQKLDYQREEVEKKLKFVNDQLTITHDNLSKSQLEIKDFKQSNTVATIPNSASTLLNAMVD


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDTQLQQANMKLSVLEGLIRQMKTGNGINFVSIDVLGAPNSSINNIITALQQKNAARTALLAEYTPKHPDVIEISEEISA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEVSLRGSIKSLYNSVQKQKNDLETTKKSYEYSLGGMPSSELGLMNLSRNFEVNQKMYSYLLEKKAEFEIMNAATISKNR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILDNAIVYPQPIKPKRSLIMMVGFILGLILGLFVAFIKEFFNNKIITPEDIERITDIPMYGVVPENTQEETAFIESLNMI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTNMEFISSESNSKVIMISSNIPEEGKTTISANLARTLAKGNKKVVLLDLDMRKSKLLREFSNLNVKDGSSSLLVGKVAL
                  SSNIPEEGKTTISANLARTLAKGNKKVVLLDLDMRKSKLLREFSNLNVKDGSSSLLVGKVAL
                         GKT                 VLLDLDMR                           
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DDVIIHAGENLDVIFAGKIPPNPSELLLSSNVEKIVNELKNSYDYVIIDTAPIGLVTDTMILLKKHIHDLFLVVVRSEFT
DDVIIHAGENLDVIFAGKIPPNPSELLLSSNVEKIVNELKNSYDYVIIDTAPIGLVTDTMILLKKHIHDLFLVVVRSEFT
                                             VIIDTAP                            
       570       580       590       600       610
....:....|....:....|....:....|....:....|....:....|
DKSLLVNFNKMTHKHHLHSVGLILNGVKISQGNYYGYGYGYGYGTNEKIK
DKSLLVNFNKMTHKHHLHSVGLILNGVKISQGNYYGYGYGYGYGTNEKI 
                                 YYGYGYGYGY       
© 1998-2019