BYKdb

Annotate results for A0A0S6X1X6

A0A0S6X1X6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0S6X1X6
DOMAINcd152/343TSSKESEGKSSSCEAIARDLAALGKSVLLVDADLRRPTLHSKFCDRKAPGLSAYLTGNAS
FEEVLQPSGVENLTCITALPIPLQPSLLLGGVRLGELVARARAMFDVVILDCPPMLGLSD
TASISAYVDGVLVVIDAQAYHRGAVKSVLRRLQLTGAPVLGVALTKFDTQRAHGQYSYYG
NNYYQYGDASKA
SITE-175/-177GKS
SITEWalker A'179/186LLVDADLR
SITEWalker B259/265VILDCPP
SITEY Cluster327/337YSYYGNNYYQY
SITEWalker A159/161GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDEQNSGVQYNLLKRVADTNRSLYDTLLARFNQLNAASGAVSNNITVVDYAEVPTTPSSPKMLINLVIALLIGLVVSALV


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILLREYFDDAIRSPEDVERKLGIPLLALVPNSEDVQSAISNVRSPVAEAYHTLVANLSLSTQTGLPRVLMLTSSKESEGK
                                                                       TSSKESEGK
                                                                              GK
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSSCEAIARDLAALGKSVLLVDADLRRPTLHSKFCDRKAPGLSAYLTGNASFEEVLQPSGVENLTCITALPIPLQPSLLL
SSSCEAIARDLAALGKSVLLVDADLRRPTLHSKFCDRKAPGLSAYLTGNASFEEVLQPSGVENLTCITALPIPLQPSLLL
S                 LLVDADLR                                                      
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGVRLGELVARARAMFDVVILDCPPMLGLSDTASISAYVDGVLVVIDAQAYHRGAVKSVLRRLQLTGAPVLGVALTKFDT
GGVRLGELVARARAMFDVVILDCPPMLGLSDTASISAYVDGVLVVIDAQAYHRGAVKSVLRRLQLTGAPVLGVALTKFDT
                  VILDCPP                                                       
       330       340   
....:....|....:....|...
QRAHGQYSYYGNNYYQYGDASKA
QRAHGQYSYYGNNYYQYGDASKA
      YSYYGNNYYQY      
© 1998-2019