BYKdb

Annotate results for A0A0S7BVT9

A0A0S7BVT9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0S7BVT9
DOMAINcd65/253TSAIPKEGKSGIAINLSISFVEIGKKVILIDADLRKPMLSSYLGENPADAKGLSTVLTGC
DLYASILHTKFHFDFLPAGLIPPNPVELLGSRQMGEILCELRNEYDFIVIDTPPVSLLTD
AVTLCQFVDGIIFVIRQKTASIDQIKFAMKKLESVKANVIGAILNDYVVPKDSSQSKNYY
NNYSDYYQH
SITEWalker A72/74GKS
SITEWalker A'92/99ILIDADLR
SITEWalker B172/178IVIDTPP
SITEY Cluster243/251YYNNYSDYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLTMDRKLLTNFFRKNQKINDQNIRSLKKITDENSPFQFVEAYKSLRTNIDFVSVNKRYQTIEITSAIPKEGKSGIAINL
                                                                TSAIPKEGKSGIAINL
                                                                       GKS      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SISFVEIGKKVILIDADLRKPMLSSYLGENPADAKGLSTVLTGCDLYASILHTKFHFDFLPAGLIPPNPVELLGSRQMGE
SISFVEIGKKVILIDADLRKPMLSSYLGENPADAKGLSTVLTGCDLYASILHTKFHFDFLPAGLIPPNPVELLGSRQMGE
           ILIDADLR                                                             
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILCELRNEYDFIVIDTPPVSLLTDAVTLCQFVDGIIFVIRQKTASIDQIKFAMKKLESVKANVIGAILNDYVVPKDSSQS
ILCELRNEYDFIVIDTPPVSLLTDAVTLCQFVDGIIFVIRQKTASIDQIKFAMKKLESVKANVIGAILNDYVVPKDSSQS
           IVIDTPP                                                              
       250    
....:....|....
KNYYNNYSDYYQHK
KNYYNNYSDYYQH 
  YYNNYSDYY   
© 1998-2019