BYKdb

Annotate results for A0A0S7WF31

A0A0S7WF31 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0S7WF31
DOMAINcd40/228TSAVRGEGKSTTAAYLAITAARYRKTKTLLVDGDLRKPKVHTLFQLRNQPGLSDVLSGAS
SLKACFKSTSLEELKILTAGKARLSPSESFDSDRMKDVFEEMRFYFDVIIVDAAPVIAVS
DPIILGSEVGGVLLVVMAGKTPREVVKRAKNILADSSVNILGVVLNNADEVLPYYYDYRY
YGYPGTDEK
SITE-178/-180GKT
SITEWalker A'68/75LLVDGDLR
SITEWalker B148/154IIVDAAP
SITEY Cluster213/222YYYDYRYYGY
SITEWalker A47/49GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKSVLQRYEVESPEATEFRRLFSRLRRTGEPEPVKSILITSAVRGEGKSTTAAYLAITAARYRKTKTLLVDGDLRKPKVH
                                       TSAVRGEGKSTTAAYLAITAARYRKTKTLLVDGDLRKPKVH
                                              GKS                  LLVDGDLR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLFQLRNQPGLSDVLSGASSLKACFKSTSLEELKILTAGKARLSPSESFDSDRMKDVFEEMRFYFDVIIVDAAPVIAVSD
TLFQLRNQPGLSDVLSGASSLKACFKSTSLEELKILTAGKARLSPSESFDSDRMKDVFEEMRFYFDVIIVDAAPVIAVSD
                                                                   IIVDAAP      
       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
PIILGSEVGGVLLVVMAGKTPREVVKRAKNILADSSVNILGVVLNNADEVLPYYYDYRYYGYPGTDEK
PIILGSEVGGVLLVVMAGKTPREVVKRAKNILADSSVNILGVVLNNADEVLPYYYDYRYYGYPGTDEK
                                                    YYYDYRYYGY      
© 1998-2019