BYKdb

Annotate results for A0A0S7WGH6

A0A0S7WGH6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0S7WGH6
DOMAINcd41/229TSSVRGEGKSTTAAYLAITVARYRNTRTLLVDGDLRKPKLHELFQLRIRPGLSEVLAGVA
SLKSCFQSTSLESLKILAAGSASLFPSESFDSDRMKGVFEEVKFYFDVIIVDGAPVIAVS
DPIILGSEVDGVLFVIMAGKTPREVVKRAKDLLSDSNVNVVGAVLNNVDEVLPYYYDYRY
YGYAYRGTG
SITE-179/-181GKT
SITEWalker A'69/76LLVDGDLR
SITEWalker B149/155IIVDGAP
SITEY Cluster214/225YYYDYRYYGYAY
SITEWalker A48/50GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLSVLKQYEIESPVATEFRRLYSRLRRAGEGSSLKSVLVTSSVRGEGKSTTAAYLAITVARYRNTRTLLVDGDLRKPKL
                                        TSSVRGEGKSTTAAYLAITVARYRNTRTLLVDGDLRKPKL
                                               GKS                  LLVDGDLR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HELFQLRIRPGLSEVLAGVASLKSCFQSTSLESLKILAAGSASLFPSESFDSDRMKGVFEEVKFYFDVIIVDGAPVIAVS
HELFQLRIRPGLSEVLAGVASLKSCFQSTSLESLKILAAGSASLFPSESFDSDRMKGVFEEVKFYFDVIIVDGAPVIAVS
                                                                    IIVDGAP     
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
DPIILGSEVDGVLFVIMAGKTPREVVKRAKDLLSDSNVNVVGAVLNNVDEVLPYYYDYRYYGYAYRGTG
DPIILGSEVDGVLFVIMAGKTPREVVKRAKDLLSDSNVNVVGAVLNNVDEVLPYYYDYRYYGYAYRGTG
                                                     YYYDYRYYGYAY    
© 1998-2019