BYKdb

Annotate results for A0A0S7XD06

A0A0S7XD06 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S7XD06
DOMAINtad9/171KEPSFREYFHILYRNRLLVASIFFLTVAVTTVFSFTTKKVYEARSTIMVEVGGRAGGIES
LFGVRSAMQSSVVNEVILNNQVEILRSRTLAERTISKLRNLPVSDRLELFASEDGKASMA
SLIERLSPAVEISPIQNTNIIVVKARAGKPYEASLIANTIVET
DOMAINcd558/747TSPGPTEGKSTVVANLGFVMAQAKNKTVVIDSDLRRPTVSLLLGTPKGAGLTDVLSGKAV
LDDVITSTSVDGLFLVGTGTLPPNPSEMLGSLRMRQVIAELAAKFEFVLFDSPPVLPISD
AAALGARVDGVLMVARCGVTGVAGLSRAISVMRGVHARVIGIILNDLDIRQRLGEGYYDY
YRSYSHAQGA
SITEWalker A565/567GKS
SITEWalker A'585/592VVIDSDLR
SITEWalker B665/671VLFDSPP
SITEY Cluster734/741YYDYYRSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFSRDSERKEPSFREYFHILYRNRLLVASIFFLTVAVTTVFSFTTKKVYEARSTIMVEVGGRAGGIESLFGVRSAMQSSV
        KEPSFREYFHILYRNRLLVASIFFLTVAVTTVFSFTTKKVYEARSTIMVEVGGRAGGIESLFGVRSAMQSSV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VNEVILNNQVEILRSRTLAERTISKLRNLPVSDRLELFASEDGKASMASLIERLSPAVEISPIQNTNIIVVKARAGKPYE
VNEVILNNQVEILRSRTLAERTISKLRNLPVSDRLELFASEDGKASMASLIERLSPAVEISPIQNTNIIVVKARAGKPYE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASLIANTIVETYLELNLSWARGEVTEIKSFVEEQLTLVRERLSSAEDKLKRFQESEKVASLSHETEAAVKKLAEFDALKG
ASLIANTIVET                                                                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAEVDLESTQRRLTFLETQLSDQRKSLVDDIGRVSAPMVTQLRGTLANLEGIRTRYLAQGYPENHEKMKEIERRIEETKG


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLVTKTKSALSEEVSLQDPFSYSQELIERILDLEVEVRTLRARVEGFDQLVSQYAVELERLPGKALALARLEREREVNEQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILLMLMDRYEEARIKEAGQLGNASVVDRAEEPREPILPRKRRNVLLGSVAGLLLGLLCVFSLERLRDRIADVSDVETATD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GIPVLAAIPSATTKRRGFRLLRTRRRVFPFQGSSGEAVPKVLLTELSPRSEISESYRTLRTNILFSQVDKPLRTIVLTSP
                                                                             TSP

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPTEGKSTVVANLGFVMAQAKNKTVVIDSDLRRPTVSLLLGTPKGAGLTDVLSGKAVLDDVITSTSVDGLFLVGTGTLPP
GPTEGKSTVVANLGFVMAQAKNKTVVIDSDLRRPTVSLLLGTPKGAGLTDVLSGKAVLDDVITSTSVDGLFLVGTGTLPP
    GKS                 VVIDSDLR                                                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPSEMLGSLRMRQVIAELAAKFEFVLFDSPPVLPISDAAALGARVDGVLMVARCGVTGVAGLSRAISVMRGVHARVIGII
NPSEMLGSLRMRQVIAELAAKFEFVLFDSPPVLPISDAAALGARVDGVLMVARCGVTGVAGLSRAISVMRGVHARVIGII
                        VLFDSPP                                                 
       730       740       750 
....:....|....:....|....:....|.
LNDLDIRQRLGEGYYDYYRSYSHAQGADEPS
LNDLDIRQRLGEGYYDYYRSYSHAQGA    
             YYDYYRSY          

© 1998-2019