BYKdb

Annotate results for A0A0S7Z9Q9

A0A0S7Z9Q9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0S7Z9Q9
DOMAINcd608/795TSPAPNEGKSMISSNLAVAFSEVGRRTLLIDGDTRRGDAHRLLGRERSPGLIDHLRGETG
QDIIQATDHPNLDFIGCGSRGVSTPELLASPRMAYFIGTLKRTYDVIIIDCPPLASGGDP
LILGSLTGNLAVVIRTGATEKALAQAKIDQLSRLPIRILGAILNDVSAHDTYHSYYASYL
PSYEPVPE
SITEWalker A615/617GKS
SITEWalker A'635/642LLIDGDTR
SITEWalker B714/720IIIDCPP
SITEY Cluster779/790YHSYYASYLPSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDEQFALPAAPSDGPGGEIQLRDAAAAAAAPPVWDEGFYPPSDDGDGGIDFRRYLVSILRHKWLVASSLLVGVVGSVFVW


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRTAVTYTAEGNLWIEAEARTAADLGPNEPSGLLQDNAWVELLESFQVLDTVAVRERLFLRVPADYEPAFQRFSLADEVG


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGTYVLRVSESGADFVLTTDDGTLVQQAAFGVPIGENVGFRWNPAPGSFPPEAVVRFRVLTARDAGQQLRDQLQTQIDRA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GNFIRLTLSGPNPEKIASILNAVMDRHVTIAAELKRNKLDQTLIVLEEQLTQAEAQLQRSERSLEEFRVSTISLPTDQSM


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PIAPGLQITRDPTFGNFFDMRVRLDELQQDRRRLQAVIDDFGQRDVRIEALELIPATAGSSELRRILDELVDARSELRAL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDRYSDDYPPIQDLLNQIESIETTAIPRVVLGIMRELEDQEAELSARLATAQAELQAIPPRTIEEQRLSRQVATNTDLYN


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVRGRVESARLAAASSIPDVRILDPARVPNQPSDDERMLRAGLVFFGCFGLGLLGAVLLDRVDARFRFASDVGRVIGLDI


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGSIPRIESANGRRGVLNAAQALEAFRELRIHVSFAYGSAGPITLAVTSPAPNEGKSMISSNLAVAFSEVGRRTLLIDGD
                                               TSPAPNEGKSMISSNLAVAFSEVGRRTLLIDGD
                                                      GKS                 LLIDGD
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRRGDAHRLLGRERSPGLIDHLRGETGQDIIQATDHPNLDFIGCGSRGVSTPELLASPRMAYFIGTLKRTYDVIIIDCPP
TRRGDAHRLLGRERSPGLIDHLRGETGQDIIQATDHPNLDFIGCGSRGVSTPELLASPRMAYFIGTLKRTYDVIIIDCPP
TR                                                                       IIIDCPP
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LASGGDPLILGSLTGNLAVVIRTGATEKALAQAKIDQLSRLPIRILGAILNDVSAHDTYHSYYASYLPSYEPVPEEGDEV
LASGGDPLILGSLTGNLAVVIRTGATEKALAQAKIDQLSRLPIRILGAILNDVSAHDTYHSYYASYLPSYEPVPE     
                                                          YHSYYASYLPSY          
       810       820   
....:....|....:....|...
PTQILSGPSDRELDLEEEGARKG


© 1998-2019