BYKdb

Annotate results for A0A0S8BV70

A0A0S8BV70 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S8BV70
DOMAINtad4/167PELDLREVLHVLQEYKWVIAGITLVVMALGVVWTLRTPKIYEATATIEYDPAPSKPLGGQ
VEDVADPIGNYWATREFFQTQNMVIASRGIAERVVQKLGLQHDPTYLAQDDDATGPTGDV
EAAAIALQSGLTVEPVPDTRIVRIHARDVNPERAKLIADAVAQA
DOMAINcd525/711TSAMPLEGKTTIASNLAVTLAQFGRSVLLVDSDLRRPRLHRVLEVDNQTGLSTLVEGRSS
WKASVHQTKIDGLSVLTSGPIPPNPSELLHSEGFARVKAELLEHFDYVLFDSPPMGAVTD
AAILAPQVDGVLLVVRAGTSTVQSVAGARKQLSGVSGRLLGAILNDADLRIKGYRYGAGG
YAYRSAR
SITEWalker A532/534GKT
SITEWalker A'552/559LLVDSDLR
SITEWalker B632/638VLFDSPP
SITEY Cluster698/713YRYGAGGYAYRSARGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEEPELDLREVLHVLQEYKWVIAGITLVVMALGVVWTLRTPKIYEATATIEYDPAPSKPLGGQVEDVADPIGNYWATREF
   PELDLREVLHVLQEYKWVIAGITLVVMALGVVWTLRTPKIYEATATIEYDPAPSKPLGGQVEDVADPIGNYWATREF

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FQTQNMVIASRGIAERVVQKLGLQHDPTYLAQDDDATGPTGDVEAAAIALQSGLTVEPVPDTRIVRIHARDVNPERAKLI
FQTQNMVIASRGIAERVVQKLGLQHDPTYLAQDDDATGPTGDVEAAAIALQSGLTVEPVPDTRIVRIHARDVNPERAKLI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADAVAQAYVDKTIEDRLESTDRARDWLEHQLVVLRKELDDAELALHSFKKGHNVLSVSMEDRQNLVASDIQATHDRLTEV
ADAVAQA                                                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNQRIELEARYKRLKASLGKRPDDIDPSVMTDHPALSALVLELREKSQEHDALAVKYGSEHPTMQTLSEEIAVLTRQIAQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKEALLASAERDVEQIRTVENGLRAAADQAQSAGLNLNLREIEYRQLHRDRDNKAKLYEIVLQRLTETDLTRMLKTTHVR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILDQALLPGQPVTPNLVKNVGASLLAGLVLGLAAAFFMSRLDRTIRTVESVEGLGIPVLGVIPHLGQPASEAKSALKQIS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAQAPRDELVVVKEPMSPAAETFRMIRTNLAFMSQDDPLRSVVVTSAMPLEGKTTIASNLAVTLAQFGRSVLLVDSDLRR
                                            TSAMPLEGKTTIASNLAVTLAQFGRSVLLVDSDLRR
                                                   GKT                 LLVDSDLR 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRLHRVLEVDNQTGLSTLVEGRSSWKASVHQTKIDGLSVLTSGPIPPNPSELLHSEGFARVKAELLEHFDYVLFDSPPMG
PRLHRVLEVDNQTGLSTLVEGRSSWKASVHQTKIDGLSVLTSGPIPPNPSELLHSEGFARVKAELLEHFDYVLFDSPPMG
                                                                       VLFDSPP  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVTDAAILAPQVDGVLLVVRAGTSTVQSVAGARKQLSGVSGRLLGAILNDADLRIKGYRYGAGGYAYRSARGYAPFEKDA
AVTDAAILAPQVDGVLLVVRAGTSTVQSVAGARKQLSGVSGRLLGAILNDADLRIKGYRYGAGGYAYRSAR         
                                                         YRYGAGGYAYRSARGY       
   
...
DAA


© 1998-2019