BYKdb

Annotate results for A0A0S8DM58

A0A0S8DM58 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0S8DM58
DOMAINcd78/262TSSISGEGKTITAINLAVTIAQEIDHSILLIDADLRRPMIHNYLGMNPKYGLSDYLLKDI
DISEILVKTGIGKMVLLPAGKTVPNPQELLSSVKMEYLIKELKQRYMDRYIIIDTPPILS
FAEAISIGHCVDGVIYVVKEGQTQRKAVQNGLHLLKDINVFGVIFNAVRGMNSNGYHKGT
DYYAY
SITE-157/-159GKT
SITEWalker A'106/113LLIDADLR
SITEWalker B188/194IIIDTPP
SITE-127/-187YGLSDYLLKDIDISEILVKTGIGKMVLLPAGKTVPNPQELLSSVKMEYLIKELKQRYMDR
Y
SITEY Cluster253/262YHKGTDYYAY
SITEWalker A85/87GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKIEEALEKANKLRASNVRKKTQSLNIFERVEPREVENDYLVSLNEPNSPVAEEFRKLKSMLLRITKKDFLNTVMITSS
                                                                             TSS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISGEGKTITAINLAVTIAQEIDHSILLIDADLRRPMIHNYLGMNPKYGLSDYLLKDIDISEILVKTGIGKMVLLPAGKTV
ISGEGKTITAINLAVTIAQEIDHSILLIDADLRRPMIHNYLGMNPKYGLSDYLLKDIDISEILVKTGIGKMVLLPAGKTV
    GKT                  LLIDADLR                                               
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PNPQELLSSVKMEYLIKELKQRYMDRYIIIDTPPILSFAEAISIGHCVDGVIYVVKEGQTQRKAVQNGLHLLKDINVFGV
PNPQELLSSVKMEYLIKELKQRYMDRYIIIDTPPILSFAEAISIGHCVDGVIYVVKEGQTQRKAVQNGLHLLKDINVFGV
                           IIIDTPP                                              
       250       260  
....:....|....:....|..
IFNAVRGMNSNGYHKGTDYYAY
IFNAVRGMNSNGYHKGTDYYAY
            YHKGTDYYAY
© 1998-2019