BYKdb

Annotate results for A0A0S8FY64

A0A0S8FY64 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S8FY64
DOMAINtad15/187REFDIRHHFGVIRSRFWTIVACAVVLFTVAVLYTFQATPIYEASARLLIERRAPQVSPFE
DMQERRDKEYFATQVSLITSRAVLDKALEDDRLTGLFQAEDMRQMARPGLWHSAFREVRA
VLGYEPVRPVEAWELLREIVGVRPVKDTNLVDILVRAPDANVASLVANLVAQA
DOMAINcd539/735TSAAPQDGKTVFAANLATTMAQDGKRVLLVDADLRRPALHRAFELERSPGLTNLLVEGRA
LQEIVQQPSDGQLEGLQNLYVLSAGAKTPNPAELLGSSAMARLVRQSREQYDVVIFDSCP
AMFVADAAPIASGCDGVVIVLKASKSRCKAADRARRQLAAVNGRIIGAVLNDVRPKTLRR
YGSYGYYYYDYHRYYKD
SITEWalker A546/548GKT
SITEWalker A'566/573LLVDADLR
SITEWalker B652/658VIFDSCP
SITEY Cluster719/736YGSYGYYYYDYHRYYKDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEDTLAAEAYPDEVREFDIRHHFGVIRSRFWTIVACAVVLFTVAVLYTFQATPIYEASARLLIERRAPQVSPFEDMQERR
              REFDIRHHFGVIRSRFWTIVACAVVLFTVAVLYTFQATPIYEASARLLIERRAPQVSPFEDMQERR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DKEYFATQVSLITSRAVLDKALEDDRLTGLFQAEDMRQMARPGLWHSAFREVRAVLGYEPVRPVEAWELLREIVGVRPVK
DKEYFATQVSLITSRAVLDKALEDDRLTGLFQAEDMRQMARPGLWHSAFREVRAVLGYEPVRPVEAWELLREIVGVRPVK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTNLVDILVRAPDANVASLVANLVAQAYVDYSVAARQQSAGEAFEMLQRQMKEQEKALVKAEDDLLTYREQTTIPELGTP
DTNLVDILVRAPDANVASLVANLVAQA                                                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NEQSPVLTRRRALNDEFTRVQLKRIELGVVVQANLGTGEEPQDLEELLSISIVRSDPAVAELYGRLTQIDLDLQGALRSF


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLKHPEVVALNDEREHVLSGLREAMARAVDSIHSEYAVLVAREQELVRVLLEETRVALEQARKVHVYSRLERDAERQARV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDVIVDRMREVDLTKDVGVTNVSFVERASPPQAPVRPNKQVNLILGALLGVLLGVGLAYGLEYLDDTVKTPDDVERRLNM


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PWLGYVPQMHSDGSREGLVSLAQHAIQHATDSSTEAFRSIRTNIYFSGQRGEMKTLMVTSAAPQDGKTVFAANLATTMAQ
                                                          TSAAPQDGKTVFAANLATTMAQ
                                                                 GKT            
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGKRVLLVDADLRRPALHRAFELERSPGLTNLLVEGRALQEIVQQPSDGQLEGLQNLYVLSAGAKTPNPAELLGSSAMAR
DGKRVLLVDADLRRPALHRAFELERSPGLTNLLVEGRALQEIVQQPSDGQLEGLQNLYVLSAGAKTPNPAELLGSSAMAR
     LLVDADLR                                                                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVRQSREQYDVVIFDSCPAMFVADAAPIASGCDGVVIVLKASKSRCKAADRARRQLAAVNGRIIGAVLNDVRPKTLRRYG
LVRQSREQYDVVIFDSCPAMFVADAAPIASGCDGVVIVLKASKSRCKAADRARRQLAAVNGRIIGAVLNDVRPKTLRRYG
           VIFDSCP                                                            YG
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SYGYYYYDYHRYYKDYQEDEGDELEMPASVPVAVEDERPDDGPDEEGSAERFEPGTVSFVVRGGQDFSFSFELEDGQQTV
SYGYYYYDYHRYYKD                                                                 
SYGYYYYDYHRYYKDY                                                                
       810       820       830       840       850       860       870        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
VGRSSAECDIGLPSASVSPQHCRIANSGGRIVVEDLGSANGTFVGYRRVRRATVGPGDVIRISPYTISVEGPTGNRAG


© 1998-2019