BYKdb

Annotate results for A0A0S8GJS7

A0A0S8GJS7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S8GJS7
DOMAINtad3/217QQYTLTDYINIMREHIRPIAVCTAAAAVVALLMSFILPKTYEAEVTFKLDLSESKPLFYS
PIYSQKQIDPVESQLEIIQSRTLAQTVVKELGLNFVVKDSYRTYFDSVFVADDCPPGTYY
VRFHNSEFTIVGSRGEVIGTGTVGEHYDSGALRFRINEKRADNMKLTIMTLNKRARELQK
QVRVDQIRNSQLVRLKARSRNPQVAAAIANTLANE
DOMAINcd582/768TSTIPQEGKTTTCINLAITLSQQGHKVIVVDCDFRRPMLHNYFAQYVTDNRHGLSDVLIG
RLKLESAIVRNSVHNLSFITSGTIPSNPAELLGSEKMVQMIEKLKASFEFVIIDAPPTLG
VADARVLGRICDAVLVVVKAQMTNREAVIDVKNEIERSGEKVIGFVLNGIDITSSYYRRR
YHYYRSA
SITEWalker A589/591GKT
SITEWalker A'609/616IVVDCDFR
SITEWalker B692/698VIIDAPP
SITE-623/-627YFAQY
SITEY Cluster757/765YYRRRYHYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKQQYTLTDYINIMREHIRPIAVCTAAAAVVALLMSFILPKTYEAEVTFKLDLSESKPLFYSPIYSQKQIDPVESQLEII
  QQYTLTDYINIMREHIRPIAVCTAAAAVVALLMSFILPKTYEAEVTFKLDLSESKPLFYSPIYSQKQIDPVESQLEII

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSRTLAQTVVKELGLNFVVKDSYRTYFDSVFVADDCPPGTYYVRFHNSEFTIVGSRGEVIGTGTVGEHYDSGALRFRINE
QSRTLAQTVVKELGLNFVVKDSYRTYFDSVFVADDCPPGTYYVRFHNSEFTIVGSRGEVIGTGTVGEHYDSGALRFRINE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRADNMKLTIMTLNKRARELQKQVRVDQIRNSQLVRLKARSRNPQVAAAIANTLANEYINYSLRTVREVARGSKEFIESQ
KRADNMKLTIMTLNKRARELQKQVRVDQIRNSQLVRLKARSRNPQVAAAIANTLANE                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILIFGEELNHAEEDLRQYKEKAGIFLLNASAHEIISSLAQFETERERAIVALHESESAIENLEAELSRDAASYGAYKQMA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFPTLSSSPIIVSLKDKLQTLELQKQEMAQTDVGSNDVPRIEAQIQKTEEELQKATRQIVLAGPSIDDPVFRSIITQIID


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QETRAISLQSRIAALNQIIGRQNARLKQLPEAEVELAQLERQKMANENIYTMLLGKLEESKIAEAMQISEARIIDVANVP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERPTHPRPVLNAVLGVLLGLMIGVGGVILKERLDTSVKTAKELEELTGSSVLASIPLMKGKERALIATVEEPHSEIAEAY


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RILRTNIAFATTARPIQTLLVTSTIPQEGKTTTCINLAITLSQQGHKVIVVDCDFRRPMLHNYFAQYVTDNRHGLSDVLI
                     TSTIPQEGKTTTCINLAITLSQQGHKVIVVDCDFRRPMLHNYFAQYVTDNRHGLSDVLI
                            GKT                 IVVDCDFR                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRLKLESAIVRNSVHNLSFITSGTIPSNPAELLGSEKMVQMIEKLKASFEFVIIDAPPTLGVADARVLGRICDAVLVVVK
GRLKLESAIVRNSVHNLSFITSGTIPSNPAELLGSEKMVQMIEKLKASFEFVIIDAPPTLGVADARVLGRICDAVLVVVK
                                                   VIIDAPP                      
       730       740       750       760        
....:....|....:....|....:....|....:....|....:...
AQMTNREAVIDVKNEIERSGEKVIGFVLNGIDITSSYYRRRYHYYRSA
AQMTNREAVIDVKNEIERSGEKVIGFVLNGIDITSSYYRRRYHYYRSA
                                    YYRRRYHYY   

© 1998-2019