BYKdb

Annotate results for A0A0S8H0S8

A0A0S8H0S8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0S8H0S8
DOMAINcd420/607TSAQAGDGKTTLVSNLGIAMAQAAQRTLILDADLRNPMQHEVFDVACEPGLTGLLAGTAG
LQDAIRFSGVERLDVLPCGAAPDRPAEMLHSPAFRQMLAELSGRYDRIVIDSPPVVSVTD
SRILGAICEVTVLVLRAEKSTHPVAQQAIEDLLDVGARLLGAVINAVPRGNRRYGRYSQY
GYRRSHRR
SITEWalker A427/429GKT
SITEWalker A'447/454LILDADLR
SITEWalker B527/533IVIDSPP
SITEY Cluster593/601YGRYSQYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLQAALERCGGAGLKILQGRPNPVAYLKEALKIEAGKKDDIICVSLDSPYPSEADLLVNNIVEAFVSSSPGGNRSTAREI


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKTLRSEKARQAEELTANFQAMEEFKRANGIISLADGKGSIMAQRLGELSAALTVAEVEAILAKAEYDAARAMMNDPGRM


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYFAEQGSRSHLAQAGPDDAELAAAINQMQLQLVALKRQRTEGHPAVQALQAQLARARQRQAKADKKFAENHLALCAQRL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAAQQKQGEIRAALVDQQKQAEQMDARLARCALLEAAFKRSLRMNELLDSRISEVALASDVGPMFIRVLEEASSGDEPTR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PNRPHAAAMALGLGLILGVMLALLAARLDHRIHSAADVPAVLGLPLLGAVPTIRRRRSLQSGAQTVLMDPASPAAEAYRD


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IRTAVCFGVREGQVKTLLVTSAQAGDGKTTLVSNLGIAMAQAAQRTLILDADLRNPMQHEVFDVACEPGLTGLLAGTAGL
                   TSAQAGDGKTTLVSNLGIAMAQAAQRTLILDADLRNPMQHEVFDVACEPGLTGLLAGTAGL
                          GKT                 LILDADLR                          
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QDAIRFSGVERLDVLPCGAAPDRPAEMLHSPAFRQMLAELSGRYDRIVIDSPPVVSVTDSRILGAICEVTVLVLRAEKST
QDAIRFSGVERLDVLPCGAAPDRPAEMLHSPAFRQMLAELSGRYDRIVIDSPPVVSVTDSRILGAICEVTVLVLRAEKST
                                              IVIDSPP                           
       570       580       590       600       610    
....:....|....:....|....:....|....:....|....:....|....
HPVAQQAIEDLLDVGARLLGAVINAVPRGNRRYGRYSQYGYRRSHRRKASAPSE
HPVAQQAIEDLLDVGARLLGAVINAVPRGNRRYGRYSQYGYRRSHRR       
                                YGRYSQYGY             
© 1998-2019