BYKdb

Annotate results for A0A0S8H9P3

A0A0S8H9P3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S8H9P3
DOMAINtad5/225ERTHLEDYWRVVRRRAWLILLTALVALLAATWAASRRPRLYRATLTLQVGDPRGRMGQLG
DIDVTPNMLWTDPVESEVQQLTTQAVAQYVADTLQLRARSPDISRDLLLSGVRIDREAPS
GDYRIRVGSDGSVFIEPGSGAPAVRGQVGEPIEFTAGSLVVRPQIEPGDYRVHVISQLAA
EAVVTGGLAASTRPETNLIDVTYSGPDQRLVPRTLNAVAAA
DOMAINcd566/752TSPGPDEGKSTSVANLAAVLADRGDRTLLVDADLRRGTLHEDFDLLRSPGLSDLLVGELD
PREAIRPAVRPALDLLPAGKRPPNPSELLGSQAMAKLLASWREEYRWVLFDTPPVLAVTD
ASVLAALVDGAVLVVKAGETDRRAGWQAIQQLRRVGARVVGAVLNEIVLQRGADRYYFDY
YYSRSSS
SITEWalker A573/575GKS
SITEWalker A'593/600LLVDADLR
SITEWalker B673/679VLFDTPP
SITEY Cluster741/747YYFDYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGRYERTHLEDYWRVVRRRAWLILLTALVALLAATWAASRRPRLYRATLTLQVGDPRGRMGQLGDIDVTPNMLWTDPVES
    ERTHLEDYWRVVRRRAWLILLTALVALLAATWAASRRPRLYRATLTLQVGDPRGRMGQLGDIDVTPNMLWTDPVES

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVQQLTTQAVAQYVADTLQLRARSPDISRDLLLSGVRIDREAPSGDYRIRVGSDGSVFIEPGSGAPAVRGQVGEPIEFTA
EVQQLTTQAVAQYVADTLQLRARSPDISRDLLLSGVRIDREAPSGDYRIRVGSDGSVFIEPGSGAPAVRGQVGEPIEFTA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSLVVRPQIEPGDYRVHVISQLAAEAVVTGGLAASTRPETNLIDVTYSGPDQRLVPRTLNAVAAALRDLGVRRVRQWARG
GSLVVRPQIEPGDYRVHVISQLAAEAVVTGGLAASTRPETNLIDVTYSGPDQRLVPRTLNAVAAA               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTRFIRDQLDESGRQLREALQAVQDYKGRRGLISLTVEESRVMQRVATLQTEIEQLLIEKSLYTSLVDRIGSVGLRPGDV


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQFVVLSTEEVNRTVQFYYDQLLELLEERSSQLGPLGKDPSHPVIMALDQRISETQDQLVAAAENAAVALDTRIGALTGR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSNLQAELRQLPAVESELTRLQNEVEIHSDMYKYLLSRYQESQIAEAEISPYVEVLDPASWARPVSGGRRINIIFGGLLG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLLGLGAAFFLEYLDRSLKSTSDVETSLGVPVLGWIPKITGDGQRRISLVAAHDPEGVAAEAYRVLRTNIAFSTARERPL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSLAFTSPGPDEGKSTSVANLAAVLADRGDRTLLVDADLRRGTLHEDFDLLRSPGLSDLLVGELDPREAIRPAVRPALDL
     TSPGPDEGKSTSVANLAAVLADRGDRTLLVDADLRRGTLHEDFDLLRSPGLSDLLVGELDPREAIRPAVRPALDL
            GKS                 LLVDADLR                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPAGKRPPNPSELLGSQAMAKLLASWREEYRWVLFDTPPVLAVTDASVLAALVDGAVLVVKAGETDRRAGWQAIQQLRRV
LPAGKRPPNPSELLGSQAMAKLLASWREEYRWVLFDTPPVLAVTDASVLAALVDGAVLVVKAGETDRRAGWQAIQQLRRV
                                VLFDTPP                                         
       730       740       750  
....:....|....:....|....:....|..
GARVVGAVLNEIVLQRGADRYYFDYYYSRSSS
GARVVGAVLNEIVLQRGADRYYFDYYYSRSSS
                    YYFDYYY     

© 1998-2019