BYKdb

Annotate results for A0A0S8J591

A0A0S8J591 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S8J591
DOMAINtad8/157RKMHLTDYLWVLKRRVLLILFFWGLVFASVVVATFMQQPLYRAYARIEIERSVDTPDVIE
AGARRMATEEFYNSQVENLRSRRIARKLYNDMGMYNWEYFRKLGPDRDPIAVVRNWIRVS
RVPKTHHVEIWVLWPDPKMAARMVNAVTDA
DOMAINcd506/694TSTSPQEGKTTVAVNWAITLAQAGNKVLLIDGDLRKPMIHRAFNMKPDRGLSTLLSEKDS
ATVYIKKTDIENLHVLPGGPIPSNPAELLGSRKMRTLVAEAAERYDSVIIDASPVLGVAD
ANILSTMVDCVVLVVQASKNRRGLVMRAKNQLASVNARLAGAVLNNVRGTKGDYYYYRQR
YQPVAEMME
SITEWalker A513/515GKT
SITEWalker A'533/540LLIDGDLR
SITEWalker B613/619VIIDASP
SITEY Cluster679/686YYYYRQRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAVKRPERKMHLTDYLWVLKRRVLLILFFWGLVFASVVVATFMQQPLYRAYARIEIERSVDTPDVIEAGARRMATEEFYN
       RKMHLTDYLWVLKRRVLLILFFWGLVFASVVVATFMQQPLYRAYARIEIERSVDTPDVIEAGARRMATEEFYN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQVENLRSRRIARKLYNDMGMYNWEYFRKLGPDRDPIAVVRNWIRVSRVPKTHHVEIWVLWPDPKMAARMVNAVTDAYTD
SQVENLRSRRIARKLYNDMGMYNWEYFRKLGPDRDPIAVVRNWIRVSRVPKTHHVEIWVLWPDPKMAARMVNAVTDA   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILKEWRSSAFDASVRALLNRAQDIKREQDKASRAVQDFSAEREIYALPEIRSVVLTNERWLQEAAAQANVEMIAAQSLYD


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVNKAVEEGTYENTRDTDLLQRLRERLYAYQEIVELEKEDKTRRYRDQDRLSRNMEVRVEQVNQQIAVENDRMRRAAQSD


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAQKLATAQANYEFLSDMLLTNRQRLTQISRDMLQLEGLRKQQENIEEMRAVLDKAAETVKTYRSYEDIKARVISQADIP


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KGKFSPNPALNLPLGLVVGLMVGIIAAFFFEYLNTTIRMPRDIEDGLGLPVLGFVPAMSPKFKDFATRSLISHLDSRSGP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEAFRGIRTEVMLRSDLRQVKTGMVTSTSPQEGKTTVAVNWAITLAQAGNKVLLIDGDLRKPMIHRAFNMKPDRGLSTLL
                         TSTSPQEGKTTVAVNWAITLAQAGNKVLLIDGDLRKPMIHRAFNMKPDRGLSTLL
                                GKT                 LLIDGDLR                    
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEKDSATVYIKKTDIENLHVLPGGPIPSNPAELLGSRKMRTLVAEAAERYDSVIIDASPVLGVADANILSTMVDCVVLVV
SEKDSATVYIKKTDIENLHVLPGGPIPSNPAELLGSRKMRTLVAEAAERYDSVIIDASPVLGVADANILSTMVDCVVLVV
                                                    VIIDASP                     
       650       660       670       680       690        
....:....|....:....|....:....|....:....|....:....|....:...
QASKNRRGLVMRAKNQLASVNARLAGAVLNNVRGTKGDYYYYRQRYQPVAEMMEEAGV
QASKNRRGLVMRAKNQLASVNARLAGAVLNNVRGTKGDYYYYRQRYQPVAEMME    
                                      YYYYRQRY            
© 1998-2019