BYKdb

Annotate results for A0A0S8KNX5

A0A0S8KNX5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S8KNX5
DOMAINtad26/197GRVGTSNLLAGIFRRWYIVLLILFVMCAAGLPAIWFLIDPVYEVTGAVTIAPIMADILTD
VPDSGEISNYSSFMNTQAEMITSSRVVRRVADDLADRNLPFLEDEPTDPISKLKRKIDGT
QDKRTPEEILKQAITNGVIVAAADRLSELIRITVLHPDREQARQIVDAFINA
DOMAINcd553/742TSPGMKEGKTTFAINLATSIAESGKRVLLVDGDLRKPDVARLLNLPKGARGLQDVLSGVE
FEDVVYSIASSGLDVLAADYHNAADAYELLALPSTAHRIDTISKKYDHVIIDTPPALGFP
DALLWAKVGDAVILTSFAGHTTMPDLKEATDRLAQINVRVLGTVLSSVQAEHSYYRHGHS
YYAQSAQSRE
SITEWalker A560/562GKT
SITEWalker A'580/587LLVDGDLR
SITEWalker B661/667VIIDTPP
SITEY Cluster726/734YYRHGHSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSDLEKYHDQVVGQQVVNFQIPPEPGRVGTSNLLAGIFRRWYIVLLILFVMCAAGLPAIWFLIDPVYEVTGAVTIAPIMA
                         GRVGTSNLLAGIFRRWYIVLLILFVMCAAGLPAIWFLIDPVYEVTGAVTIAPIMA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DILTDVPDSGEISNYSSFMNTQAEMITSSRVVRRVADDLADRNLPFLEDEPTDPISKLKRKIDGTQDKRTPEEILKQAIT
DILTDVPDSGEISNYSSFMNTQAEMITSSRVVRRVADDLADRNLPFLEDEPTDPISKLKRKIDGTQDKRTPEEILKQAIT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NGVIVAAADRLSELIRITVLHPDREQARQIVDAFINAYTAVEVSASVEDEDKKLTILENERKLLAEKMESQRQAIYRLGQ
NGVIVAAADRLSELIRITVLHPDREQARQIVDAFINA                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EYGTVALGSRTDMMLQRVGSLLSTLTEVEAERIKLEAQVQLLELTKTQPIAPGELLSMRQSYINEDPAVVAFTANITELE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QELVVAKQTLSPTNPEIELKAELIQTLKAHLEERRQEASKAFDDLVEKEAAEAGTKQLVAKRSELEQTRQYEKGLRETLS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KEDTETIDLGRTQLTIQELQDGLLLAKEMYDTVQRRIQDLEMQRKRPARISVAYYADIARVLDKRVKYSAALVFTALVCG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLAHLRDKADQSLRTPDDVAKRIGIRIIGTTTSLHTVKPALLPERIIGDYQTIRANLGLLGGEGIPKKLVITSPGMKEG
                                                                        TSPGMKEG
                                                                               G
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTTFAINLATSIAESGKRVLLVDGDLRKPDVARLLNLPKGARGLQDVLSGVEFEDVVYSIASSGLDVLAADYHNAADAYE
KTTFAINLATSIAESGKRVLLVDGDLRKPDVARLLNLPKGARGLQDVLSGVEFEDVVYSIASSGLDVLAADYHNAADAYE
KT                 LLVDGDLR                                                     
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLALPSTAHRIDTISKKYDHVIIDTPPALGFPDALLWAKVGDAVILTSFAGHTTMPDLKEATDRLAQINVRVLGTVLSSV
LLALPSTAHRIDTISKKYDHVIIDTPPALGFPDALLWAKVGDAVILTSFAGHTTMPDLKEATDRLAQINVRVLGTVLSSV
                    VIIDTPP                                                     
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAEHSYYRHGHSYYAQSAQSRESARRSRRKLMFSVDGGVDHSSGLETSVAERSADNYSYTQSSESRKDTGRKRKKPRLSV
QAEHSYYRHGHSYYAQSAQSRE                                                          
     YYRHGHSYY                                                                  
       810      
....:....|....:.
EDGADKTDDPETPRTS


© 1998-2019