BYKdb

Annotate results for A0A0S9CBJ4

A0A0S9CBJ4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S9CBJ4
DOMAINtad11/169ERQDLAGLFSRLKRHLPIILACVIVAVVLAWAVSKVLPRRYTASAQLEYTPQNAVAGAPQ
AQLSDLGRDAKIDAEVQTMKSLPVAVRVVEQLKLDRDPELRDAAKDFATDAATGKQAIAG
ALLANMSAARVGTTSLFEVGYTDKNPLKAMQIANAFAQS
DOMAINcd512/703TSALPKEGKTTTSMSVARVLATGGSRTLLLDTDLRRRSVTVALAPQAQIGLSEVLAGTAT
LDQVIVREEATGLDVLPLAPTIGTSSHIFETPDFSALIAELRRRYEHIVVDTAPVLAVAD
TRVLAHHFDALALLVRWRSTPARAARAALHQITSVGAGVTGVALTMVNLKVQSQSGFGDP
SYYADYMKDYYA
SITEWalker A519/521GKT
SITEWalker A'539/546LLLDTDLR
SITEWalker B619/625IVVDTAP
SITEY Cluster693/702YYADYMKDYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MADATNMRPEERQDLAGLFSRLKRHLPIILACVIVAVVLAWAVSKVLPRRYTASAQLEYTPQNAVAGAPQAQLSDLGRDA
          ERQDLAGLFSRLKRHLPIILACVIVAVVLAWAVSKVLPRRYTASAQLEYTPQNAVAGAPQAQLSDLGRDA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KIDAEVQTMKSLPVAVRVVEQLKLDRDPELRDAAKDFATDAATGKQAIAGALLANMSAARVGTTSLFEVGYTDKNPLKAM
KIDAEVQTMKSLPVAVRVVEQLKLDRDPELRDAAKDFATDAATGKQAIAGALLANMSAARVGTTSLFEVGYTDKNPLKAM

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QIANAFAQSFMTEDMETKIAQYREVDGRLNSQLEELRSKVERADAEVAAYRVRNNLLGQPDSVTAEQEISSIRGQLASAR
QIANAFAQS                                                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEEAAARARSAVSGSTIVGGGTNSPYSTATMSTLRQQRAQVAARVAALQSRYGERYPALADARKELDAIDGQLSREMRDL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRSAGNATQAAGSTTASLEASLAAAQSRLANNVRSSVDLAELQRTAQNARDAYQQLLTTSTQQNAQQSIMRADSRLAAPA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALPLKPSSPNVPVLMFMGAVLGLAVGLAIAYIRERWVQGLDTVDDIETMLGVDYFNSVPTPASSIEKPRTSDPAEATLLH


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLSAYTEAFRNLATSMSFTVSGVQGGKVLGITSALPKEGKTTTSMSVARVLATGGSRTLLLDTDLRRRSVTVALAPQAQI
                               TSALPKEGKTTTSMSVARVLATGGSRTLLLDTDLRRRSVTVALAPQAQI
                                      GKT                 LLLDTDLR              
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLSEVLAGTATLDQVIVREEATGLDVLPLAPTIGTSSHIFETPDFSALIAELRRRYEHIVVDTAPVLAVADTRVLAHHFD
GLSEVLAGTATLDQVIVREEATGLDVLPLAPTIGTSSHIFETPDFSALIAELRRRYEHIVVDTAPVLAVADTRVLAHHFD
                                                          IVVDTAP               
       650       660       670       680       690       700     
....:....|....:....|....:....|....:....|....:....|....:....|....:
ALALLVRWRSTPARAARAALHQITSVGAGVTGVALTMVNLKVQSQSGFGDPSYYADYMKDYYAQS
ALALLVRWRSTPARAARAALHQITSVGAGVTGVALTMVNLKVQSQSGFGDPSYYADYMKDYYA  
                                                    YYADYMKDYY   

© 1998-2019