BYKdb

Annotate results for A0A0S9D7J0

A0A0S9D7J0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S9D7J0
DOMAINtad1/121MTIVALCLLGALAAFAYASLSAPQYRAVSSVFVSSNRGETTGELVQGSTYTQNLVASFTE
LATKPVVLDPVIEDLDLDSSAAQLEDAVSAETPLNTVLINITAVSESPAGAANIANGVAD
S
DOMAINcd253/436SSPLPGEGKSTTAINLALAAAERNHKVLLIDADLRRPSVAEFCSIEGGVGLTTVLSSRAS
LSSVIEPWESIDVLPCGVVPPNPNQLLSSDSMAHLVKELSDVYDFIVIDSPPILLVADAL
PLARLTDGAVIVTRQHRTRRGQLAKTLQSLEGVGSDALGVILTGGKAASRTAYYGSKEQP
GPTR
SITEWalker A260/262GKS
SITEWalker A'280/287LLIDADLR
SITEWalker B358/364IVIDSPP
SITEY Cluster425/426YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTIVALCLLGALAAFAYASLSAPQYRAVSSVFVSSNRGETTGELVQGSTYTQNLVASFTELATKPVVLDPVIEDLDLDSS
MTIVALCLLGALAAFAYASLSAPQYRAVSSVFVSSNRGETTGELVQGSTYTQNLVASFTELATKPVVLDPVIEDLDLDSS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAQLEDAVSAETPLNTVLINITAVSESPAGAANIANGVADSLARVVTDMSPKTESGSPTISISTVATAQAPTFAFAPNTR
AAQLEDAVSAETPLNTVLINITAVSESPAGAANIANGVADS                                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIAAGALVGLVAGIVVALARQLLDTRIHDAGDVARLTDLPILGTIPRTRGADSGSIVLTSDPNGNVAEAYRLLATNLEF


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNPDKSLRSIVVSSPLPGEGKSTTAINLALAAAERNHKVLLIDADLRRPSVAEFCSIEGGVGLTTVLSSRASLSSVIEPW
            SSPLPGEGKSTTAINLALAAAERNHKVLLIDADLRRPSVAEFCSIEGGVGLTTVLSSRASLSSVIEPW
                   GKS                 LLIDADLR                                 
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESIDVLPCGVVPPNPNQLLSSDSMAHLVKELSDVYDFIVIDSPPILLVADALPLARLTDGAVIVTRQHRTRRGQLAKTLQ
ESIDVLPCGVVPPNPNQLLSSDSMAHLVKELSDVYDFIVIDSPPILLVADALPLARLTDGAVIVTRQHRTRRGQLAKTLQ
                                     IVIDSPP                                    
       410       420       430      
....:....|....:....|....:....|....:.
SLEGVGSDALGVILTGGKAASRTAYYGSKEQPGPTR
SLEGVGSDALGVILTGGKAASRTAYYGSKEQPGPTR
                        YY          
© 1998-2019