BYKdb

Annotate results for A0A0S9DZU4

A0A0S9DZU4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S9DZU4
DOMAINtad1/135MEFRDYVHILRRSWILIAVLLLAGIGAAAGYTFLQDPTYSSSAKVFVSTSSGSTASDLQQ
GNNFTQQRVKTYADLATTPIVLLPVISELGLGMSSSELAAAVTASAPLDTTLIEIVVTNG
DPVLAADIATSISKS
DOMAINcd269/457TSSVQGEGKSTIAVNLAIALADAGSRVLLVDADLRRPRVHEYLGLEGAVGLTDLLIGTAV
PDDVIQPWGKRDLFVLPAGKIPPNPSELLGSDALVSLIAEFNDAYDVVLFDSAPLLPVTD
GAILARTVGGTIMVSAVGRTHKNQLKGAFSVLSNVGAPVSAVVLTMLPAKAPDAYSYGYE
DVTVPEPVK
SITEWalker A276/278GKS
SITEWalker A'296/303LLVDADLR
SITEWalker B376/382VLFDSAP
SITEY Cluster443/447YSYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEFRDYVHILRRSWILIAVLLLAGIGAAAGYTFLQDPTYSSSAKVFVSTSSGSTASDLQQGNNFTQQRVKTYADLATTPI
MEFRDYVHILRRSWILIAVLLLAGIGAAAGYTFLQDPTYSSSAKVFVSTSSGSTASDLQQGNNFTQQRVKTYADLATTPI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLPVISELGLGMSSSELAAAVTASAPLDTTLIEIVVTNGDPVLAADIATSISKSLTRAVENLETPTDSDKVVSPIKMSL
VLLPVISELGLGMSSSELAAAVTASAPLDTTLIEIVVTNGDPVLAADIATSISKS                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VQEAEVPTKPISPVVPINIAVGALLGLALGVGLAVLREILDNRIRDERDVAVITTAPILGGIPFDANARERPLIVHDELH


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPRAESFRMLRTNLRFLDVGRENRSFVITSSVQGEGKSTIAVNLAIALADAGSRVLLVDADLRRPRVHEYLGLEGAVGLT
                            TSSVQGEGKSTIAVNLAIALADAGSRVLLVDADLRRPRVHEYLGLEGAVGLT
                                   GKS                 LLVDADLR                 
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLLIGTAVPDDVIQPWGKRDLFVLPAGKIPPNPSELLGSDALVSLIAEFNDAYDVVLFDSAPLLPVTDGAILARTVGGTI
DLLIGTAVPDDVIQPWGKRDLFVLPAGKIPPNPSELLGSDALVSLIAEFNDAYDVVLFDSAPLLPVTDGAILARTVGGTI
                                                       VLFDSAP                  
       410       420       430       440       450         
....:....|....:....|....:....|....:....|....:....|....:....
MVSAVGRTHKNQLKGAFSVLSNVGAPVSAVVLTMLPAKAPDAYSYGYEDVTVPEPVKAV
MVSAVGRTHKNQLKGAFSVLSNVGAPVSAVVLTMLPAKAPDAYSYGYEDVTVPEPVK  
                                          YSYGY            
© 1998-2019