BYKdb

Annotate results for A0A0S9E1G2

A0A0S9E1G2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S9E1G2
DOMAINtad1/135MELRDYIRILQKSWILIAIVLLLGVGAAAAYSILQTPKYSSSAKVFVSTSAGSTVSELQQ
GNTFTQQRVKTYADLVTTPIVLLPVISELGLDLSSDQLARMVTASAPLDTTLIEITVVSA
DNAESARIATSISES
DOMAINcd268/457TSSIESEGKSTSAANLAIALADSGLRVLLIDADLRRPKLHEYMGLEGAVGLTDLLIGTAE
PQDVIQPWGKQDLFILPAGKIPPNPSELLGSEALNKLVVEFNGAFDVVLFDAPPLLPVTD
AAILARVVGGTIVVCAAGKTHKNQLKGAFTALQNVDAPVSGVVLTMLPTKGPDAYGYGRY
GYGYGYGDID
SITE-405/-407GKT
SITEWalker A'295/302LLIDADLR
SITEWalker B375/381VLFDAPP
SITEY Cluster442/453YGYGRYGYGYGY
SITEWalker A275/277GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELRDYIRILQKSWILIAIVLLLGVGAAAAYSILQTPKYSSSAKVFVSTSAGSTVSELQQGNTFTQQRVKTYADLVTTPI
MELRDYIRILQKSWILIAIVLLLGVGAAAAYSILQTPKYSSSAKVFVSTSAGSTVSELQQGNTFTQQRVKTYADLVTTPI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLPVISELGLDLSSDQLARMVTASAPLDTTLIEITVVSADNAESARIATSISESLTRVVEEVEAPADQTASSPVKLTLV
VLLPVISELGLDLSSDQLARMVTASAPLDTTLIEITVVSADNAESARIATSISES                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QHASVSQSPVSPNVPINLALGALGGLALGIGLAVLRETLDNRIRNERDVALITEVPILGGIVFDPKARERPLIVHADPRS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRSESFRTLRTNLQFLDIGREDRSFVITSSIESEGKSTSAANLAIALADSGLRVLLIDADLRRPKLHEYMGLEGAVGLTD
                           TSSIESEGKSTSAANLAIALADSGLRVLLIDADLRRPKLHEYMGLEGAVGLTD
                                  GKS                 LLIDADLR                  
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIGTAEPQDVIQPWGKQDLFILPAGKIPPNPSELLGSEALNKLVVEFNGAFDVVLFDAPPLLPVTDAAILARVVGGTIV
LLIGTAEPQDVIQPWGKQDLFILPAGKIPPNPSELLGSEALNKLVVEFNGAFDVVLFDAPPLLPVTDAAILARVVGGTIV
                                                      VLFDAPP                   
       410       420       430       440       450       460     
....:....|....:....|....:....|....:....|....:....|....:....|....:
VCAAGKTHKNQLKGAFTALQNVDAPVSGVVLTMLPTKGPDAYGYGRYGYGYGYGDIDSKAVPAGG
VCAAGKTHKNQLKGAFTALQNVDAPVSGVVLTMLPTKGPDAYGYGRYGYGYGYGDID        
                                         YGYGRYGYGYGY            
© 1998-2019