BYKdb

Annotate results for A0A0S9PK66

A0A0S9PK66 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S9PK66
DOMAINtad1/135MELRDYLRILQKSWILIAILLLLGIAAAAAFSILQTPKYSSSAKVFVSTSGGSTVADLQQ
GNTFTQQRVKTYADLTTTPIVLLPVIADLQLDLSSGELASMISASAPLDTTLIEITVTSE
DPALAAEIATAVSAS
DOMAINcd269/458TSSIQSEGKSTSTANLAIALADTGARVLLVDADLRRPKLHEYLGLEGAVGLTDLLIGTAE
PEDVIQPWGKNDLFVLPAGKIPPNPSELLGSEALTRLLNEFNRAFDVVLFDSAPLLPVTD
AAILARTVGGTIVICAAGKTHKNQLKGALAALNNVDAPVSGIVLTMLPTKGPDAYGYGRY
GYGYGYGDVS
SITE-406/-408GKT
SITEWalker A'296/303LLVDADLR
SITEWalker B376/382VLFDSAP
SITEY Cluster443/454YGYGRYGYGYGY
SITEWalker A276/278GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELRDYLRILQKSWILIAILLLLGIAAAAAFSILQTPKYSSSAKVFVSTSGGSTVADLQQGNTFTQQRVKTYADLTTTPI
MELRDYLRILQKSWILIAILLLLGIAAAAAFSILQTPKYSSSAKVFVSTSGGSTVADLQQGNTFTQQRVKTYADLTTTPI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLPVIADLQLDLSSGELASMISASAPLDTTLIEITVTSEDPALAAEIATAVSASLTQVVENIETSGDDVQAISPVKLTL
VLLPVIADLQLDLSSGELASMISASAPLDTTLIEITVTSEDPALAAEIATAVSAS                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VQHAESAQAPVSPNVPLYIALGGVIGLALGVGVAALREALDNRVRNERDVEVITDAPILGGIVFDPKANERPLIVHDDPR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPRAESFRTLRTNLQFLDVGRTNRAFVVTSSIQSEGKSTSTANLAIALADTGARVLLVDADLRRPKLHEYLGLEGAVGLT
                            TSSIQSEGKSTSTANLAIALADTGARVLLVDADLRRPKLHEYLGLEGAVGLT
                                   GKS                 LLVDADLR                 
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLLIGTAEPEDVIQPWGKNDLFVLPAGKIPPNPSELLGSEALTRLLNEFNRAFDVVLFDSAPLLPVTDAAILARTVGGTI
DLLIGTAEPEDVIQPWGKNDLFVLPAGKIPPNPSELLGSEALTRLLNEFNRAFDVVLFDSAPLLPVTDAAILARTVGGTI
                                                       VLFDSAP                  
       410       420       430       440       450       460      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
VICAAGKTHKNQLKGALAALNNVDAPVSGIVLTMLPTKGPDAYGYGRYGYGYGYGDVSTPLASTAT
VICAAGKTHKNQLKGALAALNNVDAPVSGIVLTMLPTKGPDAYGYGRYGYGYGYGDVS        
                                          YGYGRYGYGYGY            
© 1998-2019