BYKdb

Annotate results for A0A0S9QI77

A0A0S9QI77 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S9QI77
DOMAINtad1/136MELRDYLRILRAHWLAIVILTLLGVAVAWGWTALQPKVYTANASGIVTATNAGSDTGSSL
VGDQLARSKVTSYVELGSWRAVAECAIDELGLNTTPESLVTRVDVSNPLDTVIVRVTASA
SSPEEARDLAESWLGC
DOMAINcd272/460TSPLPGDGKSTMAANLAVSLAAAGRHVVLLDADLRRPMVSTVFGLPDGAGLTDVLAGRAE
LNDVVHNVGASRNLAVITAGRVPPNPSEVLGSNRMQALVHSLTEHALVIIDSPPLLPVTD
AAVLTTAADGALIVVSAGKTTYDMLHKALANLGKANARVLGVVLNRVPRKNGGYYGYQYQ
GDYAGADTR
SITE-409/-411GKT
SITEWalker A'299/306VLLDADLR
SITEWalker B379/385VIIDSPP
SITEY Cluster445/454YYGYQYQGDY
SITEWalker A279/281GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELRDYLRILRAHWLAIVILTLLGVAVAWGWTALQPKVYTANASGIVTATNAGSDTGSSLVGDQLARSKVTSYVELGSWR
MELRDYLRILRAHWLAIVILTLLGVAVAWGWTALQPKVYTANASGIVTATNAGSDTGSSLVGDQLARSKVTSYVELGSWR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVAECAIDELGLNTTPESLVTRVDVSNPLDTVIVRVTASASSPEEARDLAESWLGCMVEQINNVEGTDETGTAAVTLVTG
AVAECAIDELGLNTTPESLVTRVDVSNPLDTVIVRVTASASSPEEARDLAESWLGC                        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSARLPTAPSSPNVRLALALGALVGLALGIGYAVVRHVLDRRLRDPRDIERETGVPVVGTLPVDKGLSVERGLADFESQH


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSSAPLAEAMRELRTNLQFMDVDNPPRAIVVTSPLPGDGKSTMAANLAVSLAAAGRHVVLLDADLRRPMVSTVFGLPDGA
                               TSPLPGDGKSTMAANLAVSLAAAGRHVVLLDADLRRPMVSTVFGLPDGA
                                      GKS                 VLLDADLR              
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLTDVLAGRAELNDVVHNVGASRNLAVITAGRVPPNPSEVLGSNRMQALVHSLTEHALVIIDSPPLLPVTDAAVLTTAAD
GLTDVLAGRAELNDVVHNVGASRNLAVITAGRVPPNPSEVLGSNRMQALVHSLTEHALVIIDSPPLLPVTDAAVLTTAAD
                                                          VIIDSPP               
       410       420       430       440       450       460
....:....|....:....|....:....|....:....|....:....|....:....|
GALIVVSAGKTTYDMLHKALANLGKANARVLGVVLNRVPRKNGGYYGYQYQGDYAGADTR
GALIVVSAGKTTYDMLHKALANLGKANARVLGVVLNRVPRKNGGYYGYQYQGDYAGADTR
                                            YYGYQYQGDY      
© 1998-2019