BYKdb

Annotate results for A0A0S9R0B0

A0A0S9R0B0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0S9R0B0
DOMAINtad1/133MELRQFLGALRARWVFSTVTFLAGAVLTVAAVFLMTPQYGSSVKLFVSTPSGGSAEYAAS
FIVTQRVASYAELATDPSVLQRVVDSLDLDMTREDLEGRVSASVITGTQTIELDVTAETP
ELAQQIAKAEAEE
DOMAINcd264/453SSALPDEGKTLVATNLALTMAQSGRSVLLIDADMRNPNVAELLGLENSVGIVTVLVGRTS
IEDATQPHVSGISFMGTGPAPPNPAEVLDTQAMRDLISRVRKEYDAVIIDAPPMLPVADA
SILMTEVDGALLLVRHGSTTREQLRLAVARIHAVGGRLFGTILNRTPRRSGDADGYGYGY
GHGYGYGYAP
SITEWalker A271/273GKT
SITEWalker A'291/298LLIDADMR
SITEWalker B370/376VIIDAPP
SITEY Cluster439/451YGYGYGHGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELRQFLGALRARWVFSTVTFLAGAVLTVAAVFLMTPQYGSSVKLFVSTPSGGSAEYAASFIVTQRVASYAELATDPSVL
MELRQFLGALRARWVFSTVTFLAGAVLTVAAVFLMTPQYGSSVKLFVSTPSGGSAEYAASFIVTQRVASYAELATDPSVL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRVVDSLDLDMTREDLEGRVSASVITGTQTIELDVTAETPELAQQIAKAEAEEVVALVEQLERPAVEDEEPAIAARIAAE
QRVVDSLDLDMTREDLEGRVSASVITGTQTIELDVTAETPELAQQIAKAEAEE                           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSISDTPVSPNIPLNLGIGLLVSLFVAIVGALLRDLLDRTVKSRQDVEKISGHSVLVTLPYDPQVKKTPLATEVGGSLAE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AFRVLRTNLQFADLDAERQAILVSSALPDEGKTLVATNLALTMAQSGRSVLLIDADMRNPNVAELLGLENSVGIVTVLVG
                       SSALPDEGKTLVATNLALTMAQSGRSVLLIDADMRNPNVAELLGLENSVGIVTVLVG
                              GKT                 LLIDADMR                      
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTSIEDATQPHVSGISFMGTGPAPPNPAEVLDTQAMRDLISRVRKEYDAVIIDAPPMLPVADASILMTEVDGALLLVRHG
RTSIEDATQPHVSGISFMGTGPAPPNPAEVLDTQAMRDLISRVRKEYDAVIIDAPPMLPVADASILMTEVDGALLLVRHG
                                                 VIIDAPP                        
       410       420       430       440       450       460       470    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
STTREQLRLAVARIHAVGGRLFGTILNRTPRRSGDADGYGYGYGHGYGYGYAPTPAAEPASSTRGRRIGRRVKR
STTREQLRLAVARIHAVGGRLFGTILNRTPRRSGDADGYGYGYGHGYGYGYAP                     
                                      YGYGYGHGYGYGY                       
© 1998-2019