BYKdb

Annotate results for A0A0T2MND3

A0A0T2MND3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0T2MND3
DOMAINtad4/176NELNLRAIFGLLRRQFRLIVVTVVAVVALATLVAFTLTPTFTSSALILVDPSNKNLLAPE
AQMNSSAADSARIDSEVELARSDNVLLRAIRDENLVTDPEFGVSIGLWPRVLTFLRLSTP
APPSGEQAVNQALSQLRSAVSVQRRGLTYLISVQVRSEQAEKAARITNAIAES
DOMAINcd517/709TSTAPNEGKTTAALALARSYSLAGYSTLLIDCDLRKPSIHRHLNLESSQGLLDFLTDEAM
RDVGVQNIVSKDNLTEMTLIVGSRRSDLPTDQLLAGPAFGRLIAAARNSFAVIVLDSPPL
APVVDGRYIARFADAVVFVLRWATTAQTDARRALANLDEATRKQAKTVVVLNQVDISRSG
YERKYGGYYAQDN
SITEWalker A524/526GKT
SITEWalker A'544/551LLIDCDLR
SITEWalker B629/635IVLDSPP
SITE-536/-541YSLAGY
SITEY Cluster697/705YERKYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDENELNLRAIFGLLRRQFRLIVVTVVAVVALATLVAFTLTPTFTSSALILVDPSNKNLLAPEAQMNSSAADSARIDSEV
   NELNLRAIFGLLRRQFRLIVVTVVAVVALATLVAFTLTPTFTSSALILVDPSNKNLLAPEAQMNSSAADSARIDSEV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELARSDNVLLRAIRDENLVTDPEFGVSIGLWPRVLTFLRLSTPAPPSGEQAVNQALSQLRSAVSVQRRGLTYLISVQVRS
ELARSDNVLLRAIRDENLVTDPEFGVSIGLWPRVLTFLRLSTPAPPSGEQAVNQALSQLRSAVSVQRRGLTYLISVQVRS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQAEKAARITNAIAESYIADQLASKVDSVLASYNVLQARIGQAREAIVSSEGQFDSFVSDNMQRIIEDSGRTDLAQMQQQ
EQAEKAARITNAIAES                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSQLQAARDQSQRSAEAVTTYLANEDWSSIVSTLQSSALDELDRQRQDLADQLSQAGSDTPTAVNLRDELAAIENRLRET


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATSEVSDLRESVTQNQTQEDTLRQRLRQEVLGSSLSADVLTRLYELQQGAELARTQYQTLLARSQDLEAQADLQLADSRI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSPALPPERPSFPNKPLIVMLAALAGLGLGGGLAFLRENLIGGFTTEEQVESVLHQQVAASVPRERAKSERESLANMMVT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
APLSLFAESIRRIRAVLDQDLYGPDEENTGSRVILVTSTAPNEGKTTAALALARSYSLAGYSTLLIDCDLRKPSIHRHLN
                                    TSTAPNEGKTTAALALARSYSLAGYSTLLIDCDLRKPSIHRHLN
                                           GKT                 LLIDCDLR         
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LESSQGLLDFLTDEAMRDVGVQNIVSKDNLTEMTLIVGSRRSDLPTDQLLAGPAFGRLIAAARNSFAVIVLDSPPLAPVV
LESSQGLLDFLTDEAMRDVGVQNIVSKDNLTEMTLIVGSRRSDLPTDQLLAGPAFGRLIAAARNSFAVIVLDSPPLAPVV
                                                                    IVLDSPP     
       650       660       670       680       690       700         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
DGRYIARFADAVVFVLRWATTAQTDARRALANLDEATRKQAKTVVVLNQVDISRSGYERKYGGYYAQDN
DGRYIARFADAVVFVLRWATTAQTDARRALANLDEATRKQAKTVVVLNQVDISRSGYERKYGGYYAQDN
                                                        YERKYGGYY    

© 1998-2019