BYKdb

Annotate results for A0A0T2ZGN4

A0A0T2ZGN4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0T2ZGN4
DOMAINtad43/241DRLDIKTLWRALLRNKGTIAGIAALCTLAASVYTLRITPQYESAALLQIDRMAQKVVNFT
AEVEVDEGPQADQLQLRTQIELLKSRSLAERVIEELGLYKPSVSSAPPAKAGDDGAALAS
GMEPLDKAMAFIGEWWGKLHELIAPSPTDKGTLSRAATVAQFQQALSVEPIRNSRLVEIR
VLNPDPELAAGIANAMAKA
DOMAINcd579/768TSCGKSEGKTTTALALAINFAQLGQKVLLIDADMRKGWMHKMLNLPNERGLSNLLSGDRD
GERLIRETAVPNLAVLTAGPVPPDPVELLMGPKLGELLEKAQALGYNQIVIDSPPLLGIA
DAIVLGNQIQNIVLAVKAGDTRKDSIKDALRRLRNAGLAPMGMVLTHARNEHAGDYAYAA
YYGHGYEDAS
SITEWalker A582/584GKS
SITEWalker A'606/613LLIDADMR
SITEWalker B687/693IVIDSPP
SITEY Cluster754/764YAYAAYYGHGY
SITEWalker A586/588GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MANTDRHPLPAVPGSRDALVSRRELALSEPMLVQGEPGTLAEDRLDIKTLWRALLRNKGTIAGIAALCTLAASVYTLRIT
                                          DRLDIKTLWRALLRNKGTIAGIAALCTLAASVYTLRIT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PQYESAALLQIDRMAQKVVNFTAEVEVDEGPQADQLQLRTQIELLKSRSLAERVIEELGLYKPSVSSAPPAKAGDDGAAL
PQYESAALLQIDRMAQKVVNFTAEVEVDEGPQADQLQLRTQIELLKSRSLAERVIEELGLYKPSVSSAPPAKAGDDGAAL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASGMEPLDKAMAFIGEWWGKLHELIAPSPTDKGTLSRAATVAQFQQALSVEPIRNSRLVEIRVLNPDPELAAGIANAMAK
ASGMEPLDKAMAFIGEWWGKLHELIAPSPTDKGTLSRAATVAQFQQALSVEPIRNSRLVEIRVLNPDPELAAGIANAMAK

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AFMATNIERKLHSSIYAREYLEEQIRQTKTKLEESERVINNYAKKNEILNLGDKGSAATQTFVDFSAALTKAEQDRIRAE
A                                                                               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLYNQVKLNPESAPQAVVNEAIRAYKEQRARLEADYARNRSIFKPEYPAMVAARAQIADLDARIKTEVNNILSSIEGQYI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AARKAEELIKNKVAGSRSEVLSVQDRSVDMNLLSRELDTNRQVYDSLLQRLKEVSVTAGITANNVSIVDEASVPLFPATP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLKVNVGLGMMLGLFLGMLTALLREQMDDSVKHATEIEALYQLPLLGLIPFTKPGKRKEPVALLAHHEPRSTFAESYRSM


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTALQFSTAEGAPQRFMVTSCGKSEGKTTTALALAINFAQLGQKVLLIDADMRKGWMHKMLNLPNERGLSNLLSGDRDGE
                  TSCGKSEGKTTTALALAINFAQLGQKVLLIDADMRKGWMHKMLNLPNERGLSNLLSGDRDGE
                     GKS GKT                 LLIDADMR                           
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLIRETAVPNLAVLTAGPVPPDPVELLMGPKLGELLEKAQALGYNQIVIDSPPLLGIADAIVLGNQIQNIVLAVKAGDTR
RLIRETAVPNLAVLTAGPVPPDPVELLMGPKLGELLEKAQALGYNQIVIDSPPLLGIADAIVLGNQIQNIVLAVKAGDTR
                                              IVIDSPP                           
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KDSIKDALRRLRNAGLAPMGMVLTHARNEHAGDYAYAAYYGHGYEDASPSRAARPAPASNTPPLPLAASTRIEPTLDPSS
KDSIKDALRRLRNAGLAPMGMVLTHARNEHAGDYAYAAYYGHGYEDAS                                
                                 YAYAAYYGHGY                                    
 
.
A


© 1998-2019