BYKdb

Annotate results for A0A0T5NSU3

A0A0T5NSU3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0T5NSU3
DOMAINcd67/249VSPNAGCGKSTVAVNLAFSLARHRDIYSLVLDFDLRRKGMTNVLGQFPSLGTADVLRRQA
DFSDVARRFGPNVAFGLNSERRVQDPSEILQSSMAAEVLEEIETKYQPDIVLFDLPPIMD
SDDNFGFLKKVDCALVVVAAEKTSMSQIDVAERHVAELTNVMGLVLNKCRYPSKTQGQVY
GKY
SITEWalker A74/76GKS
SITEWalker A'95/102LVLDFDLR
SITEWalker B177/183VLFDLPP
SITEY Cluster246/249YGKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPPKTGQSDTDRPAWEALEALQIDGKRLLHNRVTTYEHGDESAPFDLLRTRMLQQAHDNGWRRIGLVSPNAGCGKSTVAV
                                                                  VSPNAGCGKSTVAV
                                                                         GKS    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLAFSLARHRDIYSLVLDFDLRRKGMTNVLGQFPSLGTADVLRRQADFSDVARRFGPNVAFGLNSERRVQDPSEILQSSM
NLAFSLARHRDIYSLVLDFDLRRKGMTNVLGQFPSLGTADVLRRQADFSDVARRFGPNVAFGLNSERRVQDPSEILQSSM
              LVLDFDLR                                                          
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAEVLEEIETKYQPDIVLFDLPPIMDSDDNFGFLKKVDCALVVVAAEKTSMSQIDVAERHVAELTNVMGLVLNKCRYPSK
AAEVLEEIETKYQPDIVLFDLPPIMDSDDNFGFLKKVDCALVVVAAEKTSMSQIDVAERHVAELTNVMGLVLNKCRYPSK
                VLFDLPP                                                         
         
....:....
TQGQVYGKY
TQGQVYGKY
     YGKY
© 1998-2019